DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1139 and slc38a11

DIOPT Version :9

Sequence 1:NP_647686.1 Gene:CG1139 / 38264 FlyBaseID:FBgn0035300 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_017952819.1 Gene:slc38a11 / 100487061 XenbaseID:XB-GENE-6045807 Length:391 Species:Xenopus tropicalis


Alignment Length:409 Identity:80/409 - (19%)
Similarity:148/409 - (36%) Gaps:85/409 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AGYVNGTLLTLIIGSLALYCLHILIKCMYILCKRQRVPYVSFSQAMNLGLKQGPPWLRCLAPIAV 135
            ||:..|.||.:.:..:..|.:.:|||.                     |...|....:.|.....
 Frog     4 AGFPLGLLLLIGVAYVTDYSMILLIKG---------------------GSMSGTNTYQSLVSKTF 47

  Fly   136 PFVDGFLA-----FYHFGICCVYVVFIAESIKQLVDEYLVV----WDVRIHMCIIIVPLLLIYSI 191
            .|...||.     .|.|.....|.:...:.:.:::.....|    |.|..|:.|::...::...|
 Frog    48 GFPGYFLLSVLQFLYPFAAMISYNIVTGDILPKIIQRIPGVSHDSWYVDRHVVIVLSTAVITLPI 112

  Fly   192 KNLKLLAPFSSAANLLLLVGFGIILYYIF------EELPPLSERDPFVAAGKLPTFFGTVLFALE 250
            ...:.:......:.|.||:.|.:::..|.      .|:|...:...|..:.           |::
 Frog   113 ALYRNMEKLGKVSLLSLLLTFTVLVIIIVRATSLTSEIPHTEDAWDFARSN-----------AMQ 166

  Fly   251 AVGVILAIEENMATPKSFVGPC--------GILNSG----------MSIVLGLYVLLGF--FGYW 295
            ||||:           |||..|        |.|...          :|::|.|::.|.:  |||.
 Frog   167 AVGVM-----------SFVFMCHHACFLIYGSLEKATVGNWSRITHVSMLLSLFISLQYSVFGYV 220

  Fly   296 KYGNESEGSITLNIPQSEIPAQVVKVFFAITTWISYALQGYVTAHILWDKYLAKRFKETRQTFYE 360
            .:...::|.:..|..:.:..|.:.:..:|||..::|.::.:|...::.:.:........    ..
 Frog   221 SFTGFTQGDLFENYCREDNLATIGRFCYAITIILTYPMECFVAREVISNVFFGGNLPYP----LH 281

  Fly   361 LIFRAIIVLLTFGCAVAIPDLSVFLSLVGSFCLSILGLIFPVLLQICVQYTEGYGPFRIKLIINL 425
            |.....||.||...::....|.:||.|.|  .||...|:| ::...|.........:.:...:.|
 Frog   282 LAVTVAIVSLTTAVSLVYDCLGMFLELNG--VLSATPLVF-IIPPACYLKQSEKPWYHLDNAMPL 343

  Fly   426 LLLCFGIFGGVVGTYVSIL 444
            |:|..|:.....|..::||
 Frog   344 LILLLGVVIMPAGFIMAIL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1139NP_647686.1 SdaC 36..404 CDD:223884 72/367 (20%)
SLC5-6-like_sbd 42..444 CDD:294310 78/407 (19%)
slc38a11XP_017952819.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.