DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1139 and slc38a3a

DIOPT Version :9

Sequence 1:NP_647686.1 Gene:CG1139 / 38264 FlyBaseID:FBgn0035300 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001092235.1 Gene:slc38a3a / 100073328 ZFINID:ZDB-GENE-070615-25 Length:189 Species:Danio rerio


Alignment Length:186 Identity:38/186 - (20%)
Similarity:66/186 - (35%) Gaps:50/186 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELTTPTKSANGSNDDYDPHQHRELKNPTTNFQTFAHFL--------------------------- 53
            |.||.|...:.|.|  ..|..|...|...|....:.||                           
Zfish    19 EETTATAIKSQSED--AAHTDRTAGNVEANLVESSEFLSNADDKKTPRFTDFEGKTSFGMSVFNL 81

  Fly    54 -KASVGTGVLAMPSAFAHAGYVNGTLLTLIIGSLALYCLHILIKCMYILCKR--QRVPYVSFSQA 115
             .|.:|:|:|.:..|.|:.|.|...:|..::..|:.|.:|:|:|...::..|  :::.|.:|   
Zfish    82 GNAIMGSGILGLAYAMANTGIVLFVILLTVVAGLSAYSIHLLLKSSGVVGIRAYEQLGYRAF--- 143

  Fly   116 MNLGLKQGPPWLRCLAPIAVPFVDGFLAFYHFGICCVYVVFIAESIKQLVDEYLVV 171
                   |.|. :..|.||:       ...:.|....|:..:......::..:|.|
Zfish   144 -------GTPG-KMAAGIAI-------TLQNIGAMSSYLYIVKYEFPLVIQAFLKV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1139NP_647686.1 SdaC 36..404 CDD:223884 31/166 (19%)
SLC5-6-like_sbd 42..444 CDD:294310 29/160 (18%)
slc38a3aNP_001092235.1 SLC5-6-like_sbd 70..>182 CDD:294310 24/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.