DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11815 and CG12464

DIOPT Version :10

Sequence 1:NP_647685.1 Gene:CG11815 / 38263 FlyBaseID:FBgn0035299 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_610893.1 Gene:CG12464 / 36516 FlyBaseID:FBgn0033861 Length:125 Species:Drosophila melanogaster


Alignment Length:106 Identity:38/106 - (35%)
Similarity:57/106 - (53%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PLRLFIKPVILRRLSDKPKLS---NKPSNT-------PRPPKDPPDEGYQPTSVDHNGIDVPPFV 59
            |||:   |::.|....:.|::   :|..||       ||..:|.| ||..|.:::......|.|:
  Fly    10 PLRI---PLLWRPTFWRLKIAYGYSKDVNTLKRLGASPRNVRDHP-EGCTPQTLNTTAFTTPDFI 70

  Fly    60 RPSSFRQFSGPDEKLGPGAGKALPYKNPTYFGYHRFSFMEL 100
            .||::| .....|:|||.|||...||||.|:.|:|:|:.||
  Fly    71 HPSTYR-IVDKKEQLGPKAGKKQTYKNPEYYSYYRYSYYEL 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11815NP_647685.1 NDUFV3 80..112 CDD:464921 11/21 (52%)
CG12464NP_610893.1 None

Return to query results.
Submit another query.