DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCOT and LOC797311

DIOPT Version :9

Sequence 1:NP_647683.1 Gene:SCOT / 38261 FlyBaseID:FBgn0035298 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_021324906.1 Gene:LOC797311 / 797311 -ID:- Length:432 Species:Danio rerio


Alignment Length:437 Identity:268/437 - (61%)
Similarity:342/437 - (78%) Gaps:8/437 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NITGVSNNGGVDDTGLGVLIKQKQVSKVIGSYVGENTELVRQYLEGELAVELTPQGTLAEKIRAG 142
            ::.|||.: .||:.|||:|:|.||:.::|.||||||.|..||||.|||.:||||||||||:||||
Zfish     4 SLLGVSLS-WVDNFGLGMLLKSKQIKRMISSYVGENAEFGRQYLSGELELELTPQGTLAERIRAG 67

  Fly   143 GAGIPAFYTPTGYATLVQEGGAPIKYSKDGKVEISSEKKPVKEFNGKNYVMEESIFADFAFVKAQ 207
            |||||||:|||||.||:||||:||||:|||.:.|:||::.|:||||::|:||::|..|||.|||.
Zfish    68 GAGIPAFFTPTGYGTLIQEGGSPIKYNKDGTIAIASERREVREFNGRHYLMEKAITGDFALVKAW 132

  Fly   208 KADPLGNLVFNKAARNFNAPMCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKR 272
            |.|..|||:|.|..||||.|||   |:|:.|||:||.||:.:.::||:|.||::|:.||.:|.||
Zfish   133 KFDRAGNLIFRKTTRNFNQPMC---KVTIVEVEKIVDIGSFNAEDIHIPSIYVDRVVKGASYEKR 194

  Fly   273 VERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMNVML 337
            :|: |:.:.....|| .....:.:..|||.||.||||.||||||||||||:|:||||...:.|:|
Zfish   195 IEK-RLVQSGKEEKP-KVKQESDITWERIIRRAALEFQDGMYANLGIGIPMLASNYISPDITVLL 257

  Fly   338 QSENGILGLGPFPTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIRGGHVDITILGAMEVSA 402
            ||  |:|. ||:||:.:|||||||||||:|||.|||:||..|:||||||.||:|:|:||||:||.
Zfish   258 QS--GLLIXGPYPTESEVDPDLINAGKETVTVYPGAAYFSRDESFAMIRDGHIDLTMLGAMQVSK 320

  Fly   403 TGDLANWMIPGKLVKGMGGAMDLVAAPGTKVIITMEHNARDGSPKILDTCSLPLTGKGVIDMIIS 467
            .|||||||||||:|||||||||||::..|||::||||:|:.|..||||.|:||||||..:|.||:
Zfish   321 YGDLANWMIPGKMVKGMGGAMDLVSSDATKVVVTMEHSAKGGKHKILDKCTLPLTGKQCVDRIIT 385

  Fly   468 EKAVFTVEKGVGLTLIEVAEGYTVDDIIASTGAKFTVSPNLKKMGQI 514
            |||||.|:|..||||||:.:|.|.|||.|.||.:|.||.||:.|.||
Zfish   386 EKAVFDVDKSKGLTLIEILQGLTPDDIRACTGTEFEVSQNLRPMQQI 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCOTNP_647683.1 AtoD 35..268 CDD:224702 115/189 (61%)
pcaJ_scoB_fam 298..504 CDD:188219 139/205 (68%)
LOC797311XP_021324906.1 AtoD <13..189 CDD:224702 111/178 (62%)
SugarP_isomerase 219..422 CDD:320918 139/204 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D332119at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.