DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cnb and AT2G24420

DIOPT Version :9

Sequence 1:NP_001261300.1 Gene:Cnb / 38258 FlyBaseID:FBgn0035295 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_565569.1 Gene:AT2G24420 / 816978 AraportID:AT2G24420 Length:440 Species:Arabidopsis thaliana


Alignment Length:386 Identity:75/386 - (19%)
Similarity:161/386 - (41%) Gaps:79/386 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LEKMVHTLQSHLLEYQQRISVAIEVDRSKDAALTEAEQTVQSLNYEVQHLRDAVHRLEADRGESQ 306
            |...:..|:|.:.:..:.:....|:...|:..|.|.:..|.||..||..||        .:|.|.
plant    49 LNAKIRALESQIDDKTKELKGREELVTEKEKLLQERQDKVASLETEVSSLR--------KKGSSD 105

  Fly   307 SRFDALQNELSQAVNLATRFQEKNDKLERELDHCRQDAKQWEERLEQLEMQLNSSKRAEELSHAE 371
            |            |.|.::.|.:..:||::::..::..:|..:..|.:|.|.:.:::       :
plant   106 S------------VELLSKAQARATELEKQVEVLKKFLEQKNKEKELIEAQTSETEK-------K 151

  Fly   372 LNKLRDKFAKVDYQQEKLKARIEELEKENNTLTNQKEMLQEYHQKQKARADSLESHRKSLQ---- 432
            ||:|..:..|:....|:.|.:|.:||:.  ...:::|||:..|:......:.:|.|...|.    
plant   152 LNELNSRVEKLHKTNEEQKNKIRKLERA--LKISEEEMLRTKHEATTKAKELMEVHGAWLPPWFA 214

  Fly   433 ------ETLANLTETETNLK-------KKLDIQQKSLKQYYQQQMENVVAKKMQEFQDQLDKN-E 483
                  :|:|. |..:.:.|       :|:.:.:...:::.:..|.||..|.:...::.:..: |
plant   215 VHWSSFQTVAG-THWDAHGKPVMEKVTQKVTLAKNQAEKWAKPHMANVKTKYIPAIKETVKTHVE 278

  Fly   484 EHLKN-EARERERLIAERAVKQLEMINEKNNQELNLIQEKHNEEVELYRLQLANASK-KIDEMDL 546
            .|::. ..:.:|...|.::.....::  |..:.::...::..:..:.|..|:|.|:| .:|::..
plant   279 PHVQTLSTKAKEAYHASKSAVTPHIV--KFQEHVDPYYQEAKKFSKPYVDQVATATKPHVDKVRA 341

  Fly   547 KLSCYKTK-------------------RADIAEKL--HGVMEA------QWQQALAILTTP 580
            .:..|.||                   :|::..||  |.::|.      .|..|.|:|..|
plant   342 TMKPYTTKTVHYYKEFLESASTYHHQLQANVESKLKSHELLEPFATKEFIWFAASALLALP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CnbNP_001261300.1 TPR_MLP1_2 291..408 CDD:285204 23/116 (20%)
Tropomyosin 349..563 CDD:278679 45/254 (18%)
Fib_alpha <349..458 CDD:285864 24/125 (19%)
AT2G24420NP_565569.1 Apolipoprotein 46..201 CDD:279749 39/180 (22%)
SPEC <46..180 CDD:295325 35/159 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.