DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cnb and F14H3.5

DIOPT Version :9

Sequence 1:NP_001261300.1 Gene:Cnb / 38258 FlyBaseID:FBgn0035295 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_507039.3 Gene:F14H3.5 / 184491 WormBaseID:WBGene00008824 Length:224 Species:Caenorhabditis elegans


Alignment Length:241 Identity:55/241 - (22%)
Similarity:91/241 - (37%) Gaps:57/241 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LTEAEQTVQSLNYEVQHLRD-AVHRLEAD-----RGESQSRFDALQNELSQAVNLATR------- 325
            ::|.....:.:..|||.:|| :...|||:     .|.:.|...:...|.....|...|       
 Worm     1 MSEPSNNSEKVPDEVQEIRDNSEDELEAEILREQPGLTMSTHPSFNKEAENTFNSIQRCTTTLKG 65

  Fly   326 FQEKNDKLERELDHCRQDAKQWEERLEQLEMQLNSSKRAEELSHAELNKLRDKFAKVDYQQEKLK 390
            ||:..|:|:.:.....|..:|.|..::|||..:.....|.:|                     |:
 Worm    66 FQKSYDELKLQRKQSLQTIRQHEADIQQLEQGIRVHTAAFQL---------------------LR 109

  Fly   391 ARIEELEKENNTLTNQKEMLQEYHQKQKARADSLESHRKSLQETLANLTETETNLKKKLDIQQKS 455
            ..:.|:.:.|..|   :|.||..|.:.:|..|..|.....:.|...||.|        |...:|.
 Worm   110 RLLSEIRRPNQIL---QEALQARHIEIEAFDDEAERLNVLIVEERRNLVE--------LQAARKI 163

  Fly   456 LKQY---YQQQMENVVAKKMQE----FQDQLDKNEEHLKNEARERE 494
            .|.|   :|:|:..:.|:...|    .|:|:.|     |:..|.|:
 Worm   164 RKSYLIVFQKQIAQLKAENKDEEATPAQEQMTK-----KSLKRRRD 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CnbNP_001261300.1 TPR_MLP1_2 291..408 CDD:285204 26/129 (20%)
Tropomyosin 349..563 CDD:278679 34/153 (22%)
Fib_alpha <349..458 CDD:285864 22/108 (20%)
F14H3.5NP_507039.3 Smc <70..>209 CDD:224117 39/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.