DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mfap1 and AT5G17900

DIOPT Version :10

Sequence 1:NP_647679.1 Gene:Mfap1 / 38256 FlyBaseID:FBgn0035294 Length:478 Species:Drosophila melanogaster
Sequence 2:NP_197292.1 Gene:AT5G17900 / 831658 AraportID:AT5G17900 Length:435 Species:Arabidopsis thaliana


Alignment Length:118 Identity:26/118 - (22%)
Similarity:45/118 - (38%) Gaps:16/118 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VMKLFSSPLRTLRDAGKSVRISRFCSVSNVSSSLQIELVPC-LTDNYAYILHDEDTGTVGVVD-- 104
            |:.....||     .|:.:||:......:.:..::||::.| |.|...|.....:..|...:|  
plant   258 VLNELPEPL-----TGRYIRINPRSWYGDGNICMRIEILGCPLPDPNNYYHRRNEMTTSDNLDFR 317

  Fly   105 ---PSEAVPVMDALQKNSRNLTYILNTHHHYDHTGGNL---ELKDRYGAKVIG 151
               ..|...:|..:.:...|:|.:.|...  .|.|..|   |:.|..|...:|
plant   318 HHNYKEMRQLMKVVNEMCPNITRVYNIGR--SHQGLKLYAMEMSDNPGEHEVG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mfap1NP_647679.1 MFAP1 233..437 CDD:462060
AT5G17900NP_197292.1 MFAP1 173..393 CDD:462060 26/118 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.