DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dbx and HB-12

DIOPT Version :10

Sequence 1:NP_647677.2 Gene:Dbx / 38254 FlyBaseID:FBgn0261723 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_191748.1 Gene:HB-12 / 825362 AraportID:AT3G61890 Length:235 Species:Arabidopsis thaliana


Alignment Length:127 Identity:33/127 - (25%)
Similarity:49/127 - (38%) Gaps:26/127 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 FSDSQRKGLEKRFQQQKYISKPDRKKLAERLGLKDSQVKIWFQNRRMKWRN-------------- 491
            ||:.|.|.||..|:.:..:....:.::|..|||:..||.|||||:|.:|:.              
plant    34 FSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANY 98

  Fly   492 ----------SKERELLASGGSRDQTLPNKNNPNPDLSDAKCDRPLTPLSPSLLSPNGSATP 543
                      .||::.|.|  ...:.......|..:.....|......||.|..|.||.:.|
plant    99 NNLASQFEIMKKEKQSLVS--ELQRLNEEMQRPKEEKHHECCGDQGLALSSSTESHNGKSEP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DbxNP_647677.2 Homeodomain 437..491 CDD:459649 20/49 (41%)
HB-12NP_191748.1 Homeodomain 33..83 CDD:459649 19/48 (40%)
HALZ 85..126 CDD:460477 4/42 (10%)

Return to query results.
Submit another query.