DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsb and CD36

DIOPT Version :9

Sequence 1:NP_001097477.1 Gene:dsb / 38252 FlyBaseID:FBgn0035290 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_000063.2 Gene:CD36 / 948 HGNCID:1663 Length:472 Species:Homo sapiens


Alignment Length:423 Identity:121/423 - (28%)
Similarity:203/423 - (47%) Gaps:28/423 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LAVIIIGIITLILGIILSSMPWLDYFILKNLR----LWNDTLSYHYWQRPGVIRLTKLYIYNVTN 140
            :|..:||.:..:.|.||  ||..|..|.|.::    |...|:::..|.:.|.....:.:|::|.|
Human    10 IAGAVIGAVLAVFGGIL--MPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQN 72

  Fly   141 P-DGFLRGEKPHLQEVGPFVYR-EDMQKVNVKFHENNYTVSYQHKKILQFVPELSIDKDTPITTP 203
            | :..:......:::.||:.|| ..:.|.||.....:.|||:.......|.|.||:..:    ..
Human    73 PQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTE----AD 133

  Fly   204 NIPLLTLTSLSPKLGY---LLSKTISVVVTAAQFKPFINVTAEQLAFGYDDALVSLAHRFYPKHM 265
            |..:|.|...:....|   .:...::.::..::...|...|..:|.:||.|..:||..  ||   
Human   134 NFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVP--YP--- 193

  Fly   266 RPMERMGLLLGRNGTLTEVSSVKTGMDSMDQFGYIDQLNGLDHLPHWSEPPCTSIAGSEGSFFPP 330
             ....:||....|.|...|..|..|.|::.:...||...|..:|.:| |..|..|.|::.:.|||
Human   194 -VTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYW-ESHCDMINGTDAASFPP 256

  Fly   331 RELTKSEVVHIYDKDLCRIIPLKYVESLEKDGIAADLFRLPNNSYGDSAHNPENKCYDT----SE 391
             .:.||:|:..:..|:||.|...:...:...||....|.||:.::.....||:|.|:.|    |:
Human   257 -FVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISK 320

  Fly   392 YEPIQGLQNISPCQYGAPVYISNPHFFESHPDLLNSVEGLKPEREKHETYFKIQPKLGVPLEGKV 456
            .....|:.:||.|:.|.|||||.|||..:.||:...::||.|..|:|.||..|:|..|..|:...
Human   321 NCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAK 385

  Fly   457 RIQLNLKVTRAKDVYPVRDF-RDFVFPVMWLEE 488
            |:|:||.|..::.:..:::. |:::.|::||.|
Human   386 RLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsbNP_001097477.1 CD36 103..532 CDD:279474 113/400 (28%)
CD36NP_000063.2 CD36 14..463 CDD:395898 120/419 (29%)
Required for interaction with thrombospondins, THBS1 and THBS2. /evidence=ECO:0000269|PubMed:1371676 93..120 8/26 (31%)
Interaction with PTK2, PXN and LYN. /evidence=ECO:0000269|PubMed:20037584 460..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 1 1.000 - - FOG0000618
OrthoInspector 1 1.000 - - mtm8581
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.