DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsb and Snmp1

DIOPT Version :9

Sequence 1:NP_001097477.1 Gene:dsb / 38252 FlyBaseID:FBgn0035290 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001262803.1 Gene:Snmp1 / 42514 FlyBaseID:FBgn0260004 Length:551 Species:Drosophila melanogaster


Alignment Length:520 Identity:125/520 - (24%)
Similarity:218/520 - (41%) Gaps:72/520 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LSMLISNGVRISNNRLAVIIIG--IITLILGIILSSM----PWLDYFILKNLRLWNDT-LSYHYW 122
            :.:|:.:|...    :..||.|  |...||..::|..    |..|.     ..||::| ...|::
  Fly     6 VKLLMGSGAMF----VFAIIYGWVIFPKILKFMISKQVTLKPGSDV-----RELWSNTPFPLHFY 61

  Fly   123 QRPGVIRLTKLYIYNVTNPDGFLRGEKPHLQEVGPFVYREDMQKVNVKFHENNYTVSYQHKKILQ 187
                      :|::||||||....|.||.||||||||:.|...|.:::......|||:..:....
  Fly    62 ----------IYVFNVTNPDEVSEGAKPRLQEVGPFVFDEWKDKYDLEDDVVEDTVSFTMRNTFI 116

  Fly   188 FVPE--LSIDKDTPITTPNIPLLTLTSLSPK-----LGYLLSKTISVVVTAAQFKPFINVTAEQL 245
            |.|:  |.:..:..|..|: |::....:|.:     :..|:||.:|:|...|  |.|:......|
  Fly   117 FNPKESLPLTGEEEIILPH-PIMLPGGISVQREKAAMMELVSKGLSIVFPDA--KAFLKAKFMDL 178

  Fly   246 AF--------GYDDALVSLAHRFYP---KHMRPMERMGLLLGRNGTLTEVSS----VKTGMDSMD 295
            .|        ..:.:..:|...||.   |..:.:.:...|....|......|    |..|:.:..
  Fly   179 FFRGINVDCSSEEFSAKALCTVFYTGEIKQAKQVNQTHFLFSFMGQANHSDSGRFTVCRGVKNNK 243

  Fly   296 QFGYIDQLNGLDHLPHWSEPPCTSIAGSEGSFFPPRELTKSEVVHIYDKDLCRIIPLKYVESLEK 360
            :.|.:.:.........|.:..|.:..|::.:.|.| .|.|.:.:..:..||||.:...|......
  Fly   244 KLGKVVKFADEPEQDIWPDGECNTFVGTDSTVFAP-GLKKEDGLWAFTPDLCRSLGAYYQHKSSY 307

  Fly   361 DGIAADLFRLPNNSYGDSAHNPENKCY--DTSEYE--PIQGLQNISPCQYGAPVYISNPHFFESH 421
            .|:.:..:.|   ..||...:.:..|:  |..:.:  |.:|..|::.| .|.|:..|.|||:...
  Fly   308 HGMPSMRYTL---DLGDIRADEKLHCFCEDPEDLDTCPPKGTMNLAAC-VGGPLMASMPHFYLGD 368

  Fly   422 PDLLNSVEGLKPEREKHETYFKIQPKLGVPLEGKVRIQLNLKVTRAKDVYPVRDFRDFVFPVMWL 486
            |.|:..|:||.|..:.|..|...:...|.|.:...|:|.||.:...:.:.|:::....:.|:.|:
  Fly   369 PKLVADVDGLNPNEKDHAVYIDFELMSGTPFQAAKRLQFNLDMEPVEGIEPMKNLPKLILPMFWV 433

  Fly   487 EEGI---SELTPAIKRWIYLGTVIAPSAVPIGSYLMILGGAFAIIFSFVRAYQNFMFAQDPTLEI 548
            |||:   ...|..:|..::||       :.|.|.|......|:::.....||  ..:.:..:|:|
  Fly   434 EEGVQLNKTYTNLVKYTLFLG-------LKINSVLRWSLITFSLVGLMFSAY--LFYHKSDSLDI 489

  Fly   549  548
              Fly   490  489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsbNP_001097477.1 CD36 103..532 CDD:279474 111/458 (24%)
Snmp1NP_001262803.1 CD36 12..478 CDD:279474 120/499 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450736
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11923
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.