DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsb and cd36

DIOPT Version :9

Sequence 1:NP_001097477.1 Gene:dsb / 38252 FlyBaseID:FBgn0035290 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001107151.1 Gene:cd36 / 100135002 XenbaseID:XB-GENE-493679 Length:470 Species:Xenopus tropicalis


Alignment Length:421 Identity:120/421 - (28%)
Similarity:198/421 - (47%) Gaps:34/421 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IIGIITLILGIILSSMPWLDYFILKNLR----LWNDTLSYHYWQRPGVIRLTKLYIYNVTNPDGF 144
            :||.:..|||.||  .|..|..|.|.:.    :...|::|..|...|.......:||:|||||..
 Frog    14 VIGGLLAILGGIL--FPVGDMIINKEISTEAVIEEGTIAYENWIEAGSPVYRHFWIYHVTNPDEI 76

  Fly   145 LRGEKPHLQEVGPFVYR-EDMQKVNVKFHENNYTVSY--QHKKILQFVPELSIDKDTPITTPNIP 206
            :.|.||.||:.||:.|| ..:.|.|:...||| ||||  .:..|.|.......::|| .|..|:.
 Frog    77 INGGKPILQQKGPYTYRVRYLPKENITQLENN-TVSYWQPNGAIFQREGSYGPEEDT-YTVLNLA 139

  Fly   207 LLTLTSLSPKLGYLLSKTISVVVTAAQFKPFINVTAEQLAFGYDDALVSLAHRFYPKHMRPMERM 271
            :....::.|.|..||    :.::.::....|...:.::|.:||.|..:...         |::.:
 Frog   140 VAAAPAMFPALQGLL----NAIIKSSNSSLFQVRSVKELLWGYRDPFLEKI---------PIDSI 191

  Fly   272 ----GLLLGRNGTLTEVSSVKTGMDSMDQFGYIDQLNGLDHLPHWSEPPCTSIAGSEGSFFPPRE 332
                ||....|||...:..|..|...:.:...||:......||:|::..|..|.|::.:.||| .
 Frog   192 DKTTGLFYPNNGTADGIYHVYNGKGDISKVAIIDRYKEAKALPYWNDDFCDMINGTDAASFPP-S 255

  Fly   333 LTKSEVVHIYDKDLCRIIPLKYVESLEKDGIAADLFRLPNNSYGDSAHNPENKC----YDTSEYE 393
            :.|.:.::.:..::||.|...:.:.....||....|.:..::......||:|.|    :..|...
 Frog   256 VKKDKRLYFFSSEICRSIYGIFEKEYMVKGIKLYRFVVTEDAMASPTKNPDNHCFCKDFQLSRNC 320

  Fly   394 PIQGLQNISPCQYGAPVYISNPHFFESHPDLLNSVEGLKPEREKHETYFKIQPKLGVPLEGKVRI 458
            ...|:.::..||.|.|:::|.|||..:...||:||.||||.:|:||||..::|..|..:....|:
 Frog   321 TAAGVLDLRSCQGGKPIFLSLPHFLYASDYLLDSVSGLKPNKEEHETYIDVEPITGFTMHFAKRL 385

  Fly   459 QLNLKVTRAKDVYPVRDFR-DFVFPVMWLEE 488
            |:|:.:.....:..:...: :.||||.||.|
 Frog   386 QVNVMIQPTDKIEVMSKLQSELVFPVAWLNE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dsbNP_001097477.1 CD36 103..532 CDD:279474 112/402 (28%)
cd36NP_001107151.1 CD36 16..459 CDD:366481 119/419 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1106566at2759
OrthoFinder 1 1.000 - - FOG0000618
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.