DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmhs and lhfpl2a

DIOPT Version :10

Sequence 1:NP_647674.1 Gene:Tmhs / 38251 FlyBaseID:FBgn0262624 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_991226.1 Gene:lhfpl2a / 402962 ZFINID:ZDB-GENE-040426-1839 Length:225 Species:Danio rerio


Alignment Length:194 Identity:51/194 - (26%)
Similarity:90/194 - (46%) Gaps:31/194 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VLWAIFTICYAIIGIVAFVTPEW-IGDPDNDGAG---------------RLGLWQQCQRDEIFDN 75
            :||.:.:|..|...::||::.:| :|.|....||               .||::.:|.|...:..
Zfish    11 MLWTLLSIVAAFSELIAFLSTDWLVGFPRAPDAGFSPLGATAAGEAYRPTLGIYGRCIRVPHYRR 75

  Fly    76 ---CRRRWESIFEVPTFSFQLATFFMLGAI----ALALLTIFFLVCLLFMKSTRVFHLCGWMQII 133
               |........|:.:..:|....|:...|    |:|.::||.:.....||.: :|::||.:|.|
Zfish    76 GVLCGPYAVHFGEIASGFWQATAIFLAAGILLLCAVAFISIFTMCFQSIMKKS-IFNVCGLLQAI 139

  Fly   134 SAICMIVACAAFPFGWNSDDFRKICGPEANRFELGLCGIRWAYPLAIIGCIDGVVLATLAFILA 197
            :.:.:||....:|.||.|...:..|||:::.:.||||...||:..|:.|.:       |.|:.|
Zfish   140 AGLFLIVGLVLYPAGWGSQKVQLYCGPDSSPYRLGLCSAGWAFYTALAGTV-------LCFLCA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TmhsNP_647674.1 L_HMGIC_fpl 25..199 CDD:463019 51/194 (26%)
lhfpl2aNP_991226.1 L_HMGIC_fpl 9..201 CDD:463019 51/194 (26%)

Return to query results.
Submit another query.