DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and Chst10

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_006496427.1 Gene:Chst10 / 98388 MGIID:2138283 Length:374 Species:Mus musculus


Alignment Length:328 Identity:78/328 - (23%)
Similarity:146/328 - (44%) Gaps:52/328 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LPLIPE--------HAVQTLTPQEMLQVEQRMDQ------RRERLKDKCSAYGLDVLGHDAWHTP 173
            |..:||        |..:...|...:..:.|.||      |.|.:::.|....|..|.|     .
Mouse    62 LTTMPEAEKLRGEKHFPEVPKPTGKMLSDSRPDQPPVYLERLELIRNTCKEEALRNLSH-----T 121

  Fly   174 NTWEFLVNK-----KYHIIWCNVFKAASSSWMFNFNVLAGYSPSYLRKTKKILLNLARERYPRVT 233
            ...:|::::     |:.|::|...|..::.|.....||.|...|.....:.::.:..:...||::
Mouse   122 EVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLS 186

  Fly   234 ----LDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYS--FHDKLGRSIVRNYRKKPSLA 292
                :...:..:.| ..|.|.|||||||:||::||.|....:.  :..::...|:|.|||     
Mouse   187 SFSKIGIQKRLKTY-FKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRK----- 245

  Fly   293 ARAANTKFPSFPEFVHWLLDQVKR------GSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQ 351
             ....|:...|.:||.:|.|..:|      |..| :|:|.....|.||.|::.::...|:|..|.
Mouse   246 -NRTETRGIQFEDFVRYLGDPNRRWLDLQFGDHI-IHWVTYVELCAPCEIKYSVVGHHETLEADA 308

  Fly   352 LYLIEKTGLKRVIA----PVWRNMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDIQ 412
            .|::::.|:..:::    |....|....|.    :|::..::::::..||..::.||:||.|...
Mouse   309 PYILKEAGIDHLVSYPTIPPGITMYNRTKV----EQYFLGISKRDIRRLYARFEGDFKLFGYQKP 369

  Fly   413 EYL 415
            ::|
Mouse   370 DFL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 61/248 (25%)
Chst10XP_006496427.1 Sulfotransfer_2 134..366 CDD:367564 61/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.