DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and CHST10

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_004845.1 Gene:CHST10 / 9486 HGNCID:19650 Length:356 Species:Homo sapiens


Alignment Length:311 Identity:78/311 - (25%)
Similarity:146/311 - (46%) Gaps:36/311 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 IPEHAVQT---LTPQEMLQVEQRMDQRRERLKDKCSAYGLDVLGHDAWHTPNTWEFLVNK----- 182
            |||....|   |...:::|....| :|.|.:::.|....|..|.    |||.: :|::::     
Human    59 IPEELKPTGKELPDSQLVQPLVYM-ERLELIRNVCRDDALKNLS----HTPVS-KFVLDRIFVCD 117

  Fly   183 KYHIIWCNVFKAASSSWMFNFNVLAGYSPSYLRKTKKILLNLARERYPRVTLDELREAQNYSVT- 246
            |:.|::|...|..::.|.....||.|...|.....:.::.:..:...||::.....|.|....| 
Human   118 KHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTY 182

  Fly   247 --FIIARDPFERLLSAYRDKMVFALPYS--FHDKLGRSIVRNYRKKPSLAARAANTKFPSFPEFV 307
              |.|.|||||||:||::||.|....:.  :..::...|:|.||:      ....|:...|.:||
Human   183 FKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRR------NRTETRGIQFEDFV 241

  Fly   308 HWLLDQVKR------GSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTGLKRVIAP 366
            .:|.|...|      |..| :|:|.....|.||.|.:.:|...|:|.:|..|::::.|:..::: 
Human   242 RYLGDPNHRWLDLQFGDHI-IHWVTYVELCAPCEIMYSVIGHHETLEDDAPYILKEAGIDHLVS- 304

  Fly   367 VWRNMGKGRKTHELQ--QQFYAQLTRQEMLELYEYYKYDFELFDYDIQEYL 415
             :..:..|...:...  :.::..::::::..||..::.||:||.|...::|
Human   305 -YPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQKPDFL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 60/245 (24%)
CHST10NP_004845.1 Sulfotransfer_2 116..348 CDD:308913 60/240 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.