DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and chst12b.6

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_001338467.5 Gene:chst12b.6 / 798013 ZFINID:ZDB-GENE-090312-214 Length:343 Species:Danio rerio


Alignment Length:330 Identity:91/330 - (27%)
Similarity:152/330 - (46%) Gaps:62/330 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PEHAVQTLTPQEMLQVEQRMDQRRERLKDKCSA----------YGLDVLGHDAWHTPNTWEFLVN 181
            |.|...:   :.:.|.:.|...|:..:|:.|||          :..|.:.:.|.|     ..:|:
Zfish    32 PNHRASS---KHLAQFKLRQAHRKHLIKELCSANRSLNYRQKSFTFDQIPNKALH-----HLIVD 88

  Fly   182 KKYHIIWCNVFKAASSSW---MF--NFNVLAGYSPSYLRKTKKILLNLARE-------------- 227
            ..:.:|:|.|.|.|.::|   ||  :.|:.|.....||.     ||::..|              
Zfish    89 DHHRVIYCYVPKVACTNWKRVMFALSQNLKAPDGAPYLD-----LLDIPLEIIHNSTVHKTFSKL 148

  Fly   228 -----RYPRVTLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYSFHDKLGRSIVRNY-- 285
                 ||.|..:.  .:.:||: .|:..||||.||:||||||::....| |:...|.::::.|  
Zfish   149 WMRHGRYARPLMH--HKLKNYT-KFLFVRDPFVRLISAYRDKLMKPDEY-FYTHYGSTMLQRYAN 209

  Fly   286 -RKKPSLAARAANTKF-PSFPEFVHWLLD-QVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESL 347
             .:.|..|..|..... |||..|:.:||| :.::....:.|:......|.||.|.:|.|.|.|:|
Zfish   210 ISQPPDSAQEAFRAGIRPSFIHFIQYLLDPKTEKEEPFNEHWQQMHRLCHPCQIDYDFIGKLETL 274

  Fly   348 AEDQLYLIEKTGLKRVI--APVWRNMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYD 410
            .||..:|::..||.:.|  .|.:.|    |...:.:::::|.::..:..:||..|:.||:||.||
Zfish   275 DEDTEHLLKILGLDKHIHFPPGYEN----RTAVDWEKEWFANISVADRRKLYSLYETDFKLFGYD 335

  Fly   411 IQEYL 415
            ..|.|
Zfish   336 KPETL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 74/258 (29%)
chst12b.6XP_001338467.5 Sulfotransfer_2 88..334 CDD:308913 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.