DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and chst12b.4

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_001338178.3 Gene:chst12b.4 / 797712 ZFINID:ZDB-GENE-090312-166 Length:340 Species:Danio rerio


Alignment Length:318 Identity:97/318 - (30%)
Similarity:148/318 - (46%) Gaps:63/318 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 QEMLQVEQRMDQRRERLKDKCSAYG----------LDVLGHDAWHTPNTWEFLVNKKYHIIWCNV 191
            :.:.|.:.|...|:..:|:.|||..          ||.|             :|:..:.:|:|.|
Zfish    44 KHLAQFKLRQAHRKHLIKELCSANSSLNYRQKSITLDHL-------------IVDDHHRVIYCYV 95

  Fly   192 FKAASSSW---MF--NFNVLAGYSPSYL----------------RKTKKILLNLARERYPRVTLD 235
            .|.|.|:|   ||  :.|:.|.....||                ...||:.:.  ..||.|..:.
Zfish    96 PKVACSNWKRVMFVLSQNLKAPDGAPYLDPLDIPLEIIHNSTVHNTFKKLWMR--HGRYARPLMH 158

  Fly   236 ELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYS-FHDKLGRSIVRNY---RKKPSLAARAA 296
            :  :.:||: .|:..||||.||:||||||  ||.|.. ::.|.|..|::.|   .:.|:||..|.
Zfish   159 Q--KLKNYT-KFLFVRDPFVRLISAYRDK--FAEPNEYYYYKFGFMILQRYANISQPPTLAPEAF 218

  Fly   297 NTKF-PSFPEFVHWLLD-QVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTG 359
            .... |||..|:.:||| |.::....|.|:......|.||.|.:|.|.|.|:|.||..:|::..|
Zfish   219 RAGIRPSFSHFIKFLLDPQTEKEKPFDEHWKQIHRLCHPCQIDYDFIGKLETLDEDTEHLLKILG 283

  Fly   360 LKRVI--APVWRNMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDIQEYL 415
            |.:.|  .|.:.|    |...:.:|:::|.::..:..|||..|:.||:||.||..|.|
Zfish   284 LDKHIHFPPGYEN----RTAVDWEQEWFANISLADRRELYSLYETDFKLFGYDKPETL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 82/256 (32%)
chst12b.4XP_001338178.3 Sulfotransfer_2 85..331 CDD:308913 82/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.