DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and chst8

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_001336903.7 Gene:chst8 / 796549 ZFINID:ZDB-GENE-090410-1 Length:343 Species:Danio rerio


Alignment Length:391 Identity:93/391 - (23%)
Similarity:166/391 - (42%) Gaps:93/391 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QSPQQPQ------PQQQQQEQQQQPQQHGQFPYPVVRYPVLL---LNKNKNKDLTVVATGKTKNK 110
            |.|..|:      |..::|:.||..::|.:    :::...:|   .|.:.:...:..|.      
Zfish     2 QLPNSPKKQLSATPGSREQDSQQVTKRHRK----LLKTSAILRPHTNTSSSSSSSAAAV------ 56

  Fly   111 WRYVDKDSNQTLLPLIPEHAVQTLTPQEMLQVEQRMDQRRERLKDKCSAYGLDVLGHDAWHTP-N 174
                               |...|:.:...::....:.|:..:::.|..|..::   ....|| :
Zfish    57 -------------------AASLLSEKNTRRLSDVQEARKRIVREVCGKYRSNI---SRTITPHH 99

  Fly   175 TWEFLVNKKYHIIWCNVFKAASSSWMFNFNVLAGYSPS-------------YLRK---------T 217
            .....|..::.:::|.|.||..|:|.....||||.:.|             :|::         |
Zfish   100 VSRIYVEDRHKLLYCEVPKAGCSNWKRVLMVLAGVANSTQDINHVAVHYDNHLKRLDSFDRQGIT 164

  Fly   218 KKILLNLARERYPRVTLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYS-FHDKLGRSI 281
            |::      |.|.:|               :..|:|.|||:||:|||  |..|.| :|...|:.|
Zfish   165 KRL------ETYTKV---------------LFVREPMERLVSAFRDK--FESPNSYYHPVFGKPI 206

  Fly   282 VRNYRKKPSLAARAANTKFPSFPEFVHWLLDQVKRGSFIDMHFVAATSFCTPCLIRFDMILKFES 346
            :..||...|..|....:.. :|.||:|:||| |.|...:|:|:.|....|:||.:|:|.|.|.|:
Zfish   207 ISKYRVNASQTALKTGSGV-TFREFIHYLLD-VHRPVGMDIHWEATNQLCSPCHLRYDFIGKVET 269

  Fly   347 LAEDQLYLIEKTGLKRVIA-PVWR--NMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFD 408
            |.||..:|:.|......:. |.::  |....|.:.::.|.:::||...|....|::|..|:.:|:
Zfish   270 LEEDANFLLRKIKAPESLTYPSFKDGNPKAARTSTQITQHYFSQLNASERQRAYDFYYMDYLMFN 334

  Fly   409 Y 409
            |
Zfish   335 Y 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 73/253 (29%)
chst8XP_001336903.7 Sulfotransfer_2 106..335 CDD:308913 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.