DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and chst8

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001072529.1 Gene:chst8 / 779984 XenbaseID:XB-GENE-987442 Length:437 Species:Xenopus tropicalis


Alignment Length:438 Identity:115/438 - (26%)
Similarity:198/438 - (45%) Gaps:61/438 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YLLIFTAVSLLLL-----PLSLAYLVWNEQLQ-------KIRGFEAFNVQQQSPQQPQPQQQQ-- 66
            ::|:|.|..|::.     |   |.:|..::|.       .::|.: |......|::......|  
 Frog     9 FILLFGAAGLIVFIHLQDP---AEMVRQQRLAPEHWLNGHLKGMK-FEFSLHQPEKDCTSNNQYG 69

  Fly    67 ---QEQQQQPQQHGQF--PYPVVRYPVLLLNKN-KNKDLTVVATGKTKNKWRYVDKDSNQTLLPL 125
               :...:|..:..|.  .||..:|..||.|.| :.|.:..:.....|:..|.:.|...:.||..
 Frog    70 DTMENAAKQLMKINQVVPSYPPYQYAALLQNTNRRQKKMMFLKRENKKSTERKLLKKKTRFLLKE 134

  Fly   126 IPEHAVQTLTPQEMLQVE------------QRMDQRRERLKDKCSAY---GLDVLGHDAWHTP-N 174
            .|.......:..::.::|            :...:|::.::|.||.|   ...::      || :
 Frog   135 TPILIAMNSSAVDLTRLEINDKNGKWKKLYEMQIERKKLMRDICSKYKSSSRRII------TPYH 193

  Fly   175 TWEFLVNKKYHIIWCNVFKAASSSWMFNFNVLAGYSPSYLRKTKKILLNLAR-----ERYPRVTL 234
            .....|..|:.:::|.|.||..|:|.....||.|.:.|    ||.|..|...     :|......
 Frog   194 VSRIFVEDKHKLLYCEVPKAGCSNWKRVLMVLNGLASS----TKDIHHNTVHYGNYLKRLDSFDR 254

  Fly   235 DELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYSFHDKLGRSIVRNYRKKPSLAARAANTK 299
            :.:....|.....|..|:|||||:||:|||...|..| :|...|::|:..||:..:..|....:.
 Frog   255 NGIFYRLNTYTKMIFIREPFERLVSAFRDKFEHANNY-YHPVFGKAIISKYRRNATKEALWTGSG 318

  Fly   300 FPSFPEFVHWLLDQVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTGL-KRV 363
            . .|.||:.:||| |.|...:|:|:...:..|:||||.:|.|.||||:.||..:|:...|. |.:
 Frog   319 V-QFTEFIQYLLD-VHRPVGMDIHWDHVSRLCSPCLIDYDFIGKFESMEEDADFLLHLIGAPKNL 381

  Fly   364 IAPVW--RNMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDY 409
            ..|.:  |:..:.|.|:::.||::|||:..|....|::|..|:::|:|
 Frog   382 TFPRFKDRHSNEERTTNKITQQYFAQLSPTERQRTYDFYYMDYQMFNY 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 77/235 (33%)
chst8NP_001072529.1 Sulfotransfer_2 200..429 CDD:308913 77/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.