DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and Chst14

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_082393.3 Gene:Chst14 / 72136 MGIID:1919386 Length:376 Species:Mus musculus


Alignment Length:300 Identity:86/300 - (28%)
Similarity:120/300 - (40%) Gaps:63/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LQVEQRMDQRRERLKDKCSAYGLDVLGHDAWHTP----NTW--EFLVNKKYHIIWCNVFKAASSS 198
            |||  |.|.|...|:..|...|:.   .|.|..|    .|.  ..||:.:|..::|.|.|.|.|:
Mouse   102 LQV--REDIRNRTLRAVCGQPGMP---RDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSN 161

  Fly   199 WMFNFNVLAGYSPSYLRKTKKILLNL-----ARERYPRVTLDELR------EAQNYSVTFIIARD 252
            |.....||||           ||.|:     ...|...|.|.:||      ..|:| ..|:..||
Mouse   162 WKRVLKVLAG-----------ILNNVDVRLKMDHRSDLVFLADLRPEEIRYRLQHY-FKFLFVRD 214

  Fly   253 PFERLLSAYRDKMVFALPYSFHDKLGRSIVRNYR--KKPSLAARAANTKFPSFPEFVHWLLDQVK 315
            |.||||||||:|  |.....:..:.|..|||.||  ..||.|....     :||||:.:|:|:  
Mouse   215 PLERLLSAYRNK--FGEIREYQQRYGAEIVRRYRAGAGPSPAGDDV-----TFPEFLRYLVDE-- 270

  Fly   316 RGSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTGLKRVIAP---------VWRNM 371
            ....::.|::.....|.||.:.:|.:..:|.|..|...::|     .|.||         .|...
Mouse   271 DPEHMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLE-----WVRAPPHVRFPARQAWYRP 330

  Fly   372 GKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDI 411
            ......|    .....:.|..:.::...|..||.||.|.:
Mouse   331 ASPESLH----YHLCNVPRALLQDVLPKYILDFSLFAYPL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 70/249 (28%)
Chst14NP_082393.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..96
Sulfotransfer_2 144..364 CDD:281554 70/249 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.