DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and Chst13

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_082204.1 Gene:Chst13 / 71797 MGIID:1919047 Length:336 Species:Mus musculus


Alignment Length:299 Identity:90/299 - (30%)
Similarity:144/299 - (48%) Gaps:46/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 MLQVEQRMDQRRERLKDKCSAYGLDVLGHDAWHT--------PNTWEFLVNKKYHIIWCNVFKAA 195
            |.:|.|   ||||.|:..||.           ||        .:....||:..:.:::|.|.|.|
Mouse    63 MAEVHQ---QRRELLRRACSR-----------HTRRQRLLQPEDLRHVLVDDAHRLLYCYVPKVA 113

  Fly   196 SSSWMFNFNVLAGYS-----PSYLRKTKKILLNLARERYPRVTLDELREAQNYSVTFIIARDPFE 255
            .::|......|.|..     |::......:|.:|| :..|......||:    .:||:..|:|||
Mouse   114 CTNWKRVMLALRGRGDPSAIPAHEAHAPGLLPSLA-DFAPAEVNWRLRD----YLTFLFVREPFE 173

  Fly   256 RLLSAYRDKMVFALPYS--FHDKLGRSIVRNYR--KKPSLAARAANTKFPSFPEFVHWLLD-QVK 315
            ||.||||:|:  |.|:|  |..:.|..|||..|  .:|...||..:.:   |.||:.:||| :.:
Mouse   174 RLASAYRNKL--ARPHSAAFQRRYGTRIVRRLRPHAQPDALARGHDVR---FAEFLAYLLDPRTR 233

  Fly   316 RGSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTGLK--RVIAPVWRNMGKGRKTH 378
            |....:.|:..|.:.|.|||:|:|::.|||::|:|..::::..|..  |..||..|  .:...|.
Mouse   234 RHEPFNEHWERAHALCHPCLVRYDVVGKFETIADDAAFVLDLVGEPGLRFPAPPLR--PEKDLTR 296

  Fly   379 ELQQQFYAQLTRQEMLELYEYYKYDFELFDYDIQEYLQV 417
            |..::.:..::......|:..||.||.||:|....||::
Mouse   297 EQARRLFQDISPFYQRRLFNLYKMDFLLFNYSAPSYLRL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 73/239 (31%)
Chst13NP_082204.1 Sulfotransfer_2 99..327 CDD:281554 73/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.