DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and CHST8

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001121367.1 Gene:CHST8 / 64377 HGNCID:15993 Length:424 Species:Homo sapiens


Alignment Length:460 Identity:112/460 - (24%)
Similarity:177/460 - (38%) Gaps:127/460 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLIFTAVSLLLL-----PLSLAYLVWNEQLQKIRGFEAFNVQQQSPQQPQPQQQQQE-------- 68
            :|:|.|..|||.     |..||       .|::.|.: ||::.:.|....|....|:        
Human    17 ILLFGAAGLLLFISLQDPTELA-------PQQVPGIK-FNIRPRQPHHDLPPGGSQDGDLKEPTE 73

  Fly    69 -----------------QQQQPQQHGQFPYPVVRYPVLLLNKNKN----KDLTVVAT-------- 104
                             ...|||.      |:.|...|.|.:.:.    |.:...||        
Human    74 RVTRDLSSGAPRGRNLPAPDQPQP------PLQRGTRLRLRQRRRRLLIKKMPAAATIPANSSDA 132

  Fly   105 -------GKTKNKWRYVDKDSNQTLLPLIPEHAVQTLTPQEMLQVEQRMDQRRERLKDKCSAYGL 162
                   |....:|                            :.:.:...:|:..:::.|:.|..
Human   133 PFIRPGPGTLDGRW----------------------------VSLHRSQQERKRVMQEACAKYRA 169

  Fly   163 DVLGHDAWHTP-NTWEFLVNKKYHIIWCNVFKAASSSWMFNFNVLAGYSPSYLRKTKKILLNLAR 226
            .......  || :.....|..::.:::|.|.||..|:|.....||||.:.|    |..|..|...
Human   170 SSSRRAV--TPRHVSRIFVEDRHRVLYCEVPKAGCSNWKRVLMVLAGLASS----TADIQHNTVH 228

  Fly   227 ERYPRVTLDE------LREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYS-FHDKLGRSIVRN 284
            .......||.      |.....|: ..:..|:|||||:||:|||  |..|.| :|...|::|:..
Human   229 YGSALKRLDTFDRQGILHRLSTYT-KMLFVREPFERLVSAFRDK--FEHPNSYYHPVFGKAILAR 290

  Fly   285 YRKKPSLAARAANTKFPSFPEFVHWLLDQVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLAE 349
            ||...|..|....:.. .|||||.:||| |.|...:|:|:...:..|:||||.:|.:.||||:.:
Human   291 YRANASREALRTGSGV-RFPEFVQYLLD-VHRPVGMDIHWDHVSRLCSPCLIDYDFVGKFESMED 353

  Fly   350 DQLYLIEKTGLKRVIAPVWRNM----------GKGRKTHELQQQFYAQLTRQEMLELYEYYKYDF 404
            |..:.     |..:.||  ||:          .:.|.|..:..|::|||:..:....|::|..|:
Human   354 DANFF-----LSLIRAP--RNLTFPRFKDRHSQEARTTARIAHQYFAQLSALQRQRTYDFYYMDY 411

  Fly   405 ELFDY 409
            .:|:|
Human   412 LMFNY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 77/244 (32%)
CHST8NP_001121367.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..107 11/65 (17%)
Sulfotransfer_2 187..416 CDD:308913 77/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.918296 Normalized mean entropy S7649
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.