DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and Chst12

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_067503.3 Gene:Chst12 / 59031 MGIID:1929064 Length:419 Species:Mus musculus


Alignment Length:457 Identity:105/457 - (22%)
Similarity:180/457 - (39%) Gaps:97/457 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RAIRRYLLIFTAVSLLLLPLSLAYLVWNEQLQKIRGFEAFNVQQQSPQQPQPQQQQQEQQQQPQQ 75
            |..|.:|::.:|:.:||:      :|:.:.:.....:...::.:....:|.|.|...|:......
Mouse     5 RLFRLWLVLGSALMILLI------IVYWDNVGTAHFYLHTSLSRPHILEPLPTQGLVEENVFTSD 63

  Fly    76 HGQFPYPVVRYPVLLLNKNKNKDLTVVATGKTKNKWRYVDKDSNQTLLPLIPEHAVQTLTPQE-- 138
            ..:|      ...||.:..|:.||:                 ..:|..|.:|..:...|:..|  
Mouse    64 VDEF------LDTLLSSDAKHNDLS-----------------RRKTEQPPVPAPSKPVLSHMEEN 105

  Fly   139 -------MLQVEQRMD------QRRERLKDKCSAYGL----------DVLGHDAWHTPNTWEFLV 180
                   .....|..|      :||..|:|.|:...|          |:..::..|      .:|
Mouse   106 VRGYDWSTHDAHQNPDRDRQQAERRSLLRDFCANASLAFPTKDRSFDDIPNYELNH------LIV 164

  Fly   181 NKKYHIIWCNVFKAASSSWMFNFNVLAGYSPSYLRKTK--KILLNLARE---------------- 227
            :.::.:|:|.|.|.|.::|.   .|:...|.|.|.:..  :..|::.||                
Mouse   165 DDRHGVIYCYVPKVACTNWK---RVMIVLSESLLDRGSPYRDPLDIPREHVHNTSTHLTFNKFWR 226

  Fly   228 RYPRVTLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALP-YSFHDKLGRSIVRNYRKKPSL 291
            ||.:.:...::........|:..||||.||:||:|.|  |.|. ..|:.|....::|.|....||
Mouse   227 RYGKFSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSK--FELENEEFYRKFAVPMLRLYANHTSL 289

  Fly   292 AAR-----AANTKFPSFPEFVHWLLD-QVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLAED 350
            .|.     :|..|. ||..|:.:||| ..::.:..:.|:......|.||.|.:|.:.|.|:|.||
Mouse   290 PASVSEAFSAGLKV-SFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDED 353

  Fly   351 --QLYLIEKTGLKRVIAPVWRNMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDIQE 413
              ||....|...:....|.:||    |.....::.::|.:......:||:.|:.||.||.|...|
Mouse   354 AAQLLRFLKVDSQLHFPPSYRN----RTASSWEEDWFANIPLAWRQQLYKLYEADFVLFGYPKPE 414

  Fly   414 YL 415
            .|
Mouse   415 NL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 69/254 (27%)
Chst12NP_067503.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..99 5/37 (14%)
Sulfotransfer_2 165..410 CDD:367564 69/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.