DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and Chst11

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_067414.2 Gene:Chst11 / 58250 MGIID:1927166 Length:352 Species:Mus musculus


Alignment Length:282 Identity:83/282 - (29%)
Similarity:141/282 - (50%) Gaps:24/282 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RRERLKDKCSAYGL-----DVLGHDAWHTPNTWEFL-VNKKYHIIWCNVFKAASSSWMFNFNVLA 207
            ||:::.|.|.|...     .||      |||..:.| |::.:.:|:|.|.|.|.::|.....||:
Mouse    81 RRDQVTDTCRANSAMSRKRRVL------TPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLS 139

  Fly   208 G---YSPSYLRKTKKILLNLARERYPRVTLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFAL 269
            |   ||........:..::...:...:.::.|:.......:.|:..|:|||||:||||:|.....
Mouse   140 GRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKY 204

  Fly   270 PYSFHDKLGRSIVRNYRKKPSLAA--RAANTKFPSFPEFVHWLLD-QVKRGSFIDMHFVAATSFC 331
            ..|||.:.|..|:|..||..:..|  :..:.|   |.|||.:|:| ..:|....:.|:....|.|
Mouse   205 NTSFHKRYGTKIIRRQRKNATQEALRKGDDVK---FEEFVAYLIDPHTQREEPFNEHWQTVYSLC 266

  Fly   332 TPCLIRFDMILKFESLAEDQLYLIEKTGLKRVIA-PVWRNMGKGRKTHELQQQFYAQLTRQEMLE 395
            .||.|.:|::.|:|:|.||..|:::..|:...:. |.:..  ..|.|.|:..:|:..::.:...:
Mouse   267 HPCHIHYDLVGKYETLEEDSNYVLQLAGVSGYLKFPTYAK--STRTTDEMTTEFFQNISAEHQTQ 329

  Fly   396 LYEYYKYDFELFDYDIQEYLQV 417
            |||.||.||.:|:|.:..||::
Mouse   330 LYEVYKLDFLMFNYSVPNYLKL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 68/234 (29%)
Chst11NP_067414.2 Sulfotransfer_2 113..343 CDD:281554 68/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.