DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and si:ch211-236h17.3

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_694030.1 Gene:si:ch211-236h17.3 / 565671 ZFINID:ZDB-GENE-030131-738 Length:340 Species:Danio rerio


Alignment Length:306 Identity:92/306 - (30%)
Similarity:147/306 - (48%) Gaps:36/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 VQTLTPQEMLQ---VEQRMDQRRERLKDKCSAYGLD--VLG-HDAWHTPNTWEFLVNKKYHIIWC 189
            :|||...:.|:   |:..|..|||.|::.|..:...  ||| .|..|      .:|:.|:.:::|
Zfish    51 LQTLQENDQLEQSAVQATMQGRRELLEETCHTHTRKRRVLGPEDLRH------LIVDDKHKLLYC 109

  Fly   190 NVFKAASSSWMFNFNVLAGYSPSYLRKTKKILLNLARERYPRVTLDELREAQNYS---------- 244
            .|.|.|.::|.....||.|  ....|:...|..|.|.      ....||....||          
Zfish   110 YVPKVACTNWKRVMMVLTG--DGRYREPLAIPANEAH------IAGNLRSLSEYSTAEINKRLRT 166

  Fly   245 -VTFIIARDPFERLLSAYRDKMVFALPYSFHDKLGRSIVRNYRKKPSLAARAANTKFPSFPEFVH 308
             :.|:..|:|||||:||||:|...:...:||.:.|..|::.:|..|...|....... ||.|||:
Zfish   167 YLKFVFVREPFERLVSAYRNKFTRSYNTAFHKRYGTKIIQRHRADPQAEALEKGNDV-SFEEFVY 230

  Fly   309 WLLD-QVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTGLK-RVIAPVWRNM 371
            :|:| |.:|....:.|:....|.|.||||.:|::.|:|:||:|..|:::..|.: .|..|.  ..
Zfish   231 YLVDPQTQREEPFNEHWERVHSLCHPCLIHYDVVGKYETLAQDSRYILKLAGAEGEVKFPA--TS 293

  Fly   372 GKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDIQEYLQV 417
            ...|.|.::..:|:..::.....:||..|:.||.||:|.:..||::
Zfish   294 KSTRTTGDMAAKFFDNISPFYQKKLYNLYRMDFLLFNYSMPAYLKL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 72/240 (30%)
si:ch211-236h17.3XP_694030.1 Sulfotransfer_2 101..331 CDD:281554 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.