DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and CHST12

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001230723.1 Gene:CHST12 / 55501 HGNCID:17423 Length:414 Species:Homo sapiens


Alignment Length:394 Identity:95/394 - (24%)
Similarity:164/394 - (41%) Gaps:73/394 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HGQFPYPVVRYPVLLLNKNKNKDLTV-----------VATG-KTKNKWRYVDKDSNQTLLPLIPE 128
            |..|..|....|:.....:::::||.           ::.| |..:..|   |::.|...|...|
Human    37 HTSFSRPHTGPPLPTPGPDRDRELTADSDVDEFLDKFLSAGVKQSDLPR---KETEQPPAPGSME 98

  Fly   129 HAVQ--TLTPQEMLQVEQRMDQRRER---LKDKCSAYGL----------DVLGHDAWHTPNTWEF 178
            .:|:  ..:|::..:...:..|:.||   |:..|:...|          |:...:..|      .
Human    99 ESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIPNSELSH------L 157

  Fly   179 LVNKKYHIIWCNVFKAASSSWMFNFNVLAGYSPSYLRK------------------TKKILLNLA 225
            :|:.::..|:|.|.|.|.::|.....||:|   |.|.:                  :..:..|..
Human   158 IVDDRHGAIYCYVPKVACTNWKRVMIVLSG---SLLHRGAPYRDPLRIPREHVHNASAHLTFNKF 219

  Fly   226 RERYPRVTLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALP-YSFHDKLGRSIVRNYRKKP 289
            ..||.:::...::........|:..||||.||:||:|.|  |.|. ..|:.|....::|.|....
Human   220 WRRYGKLSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSK--FELENEEFYRKFAVPMLRLYANHT 282

  Fly   290 SLAARA-----ANTKFPSFPEFVHWLLD-QVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLA 348
            ||.|.|     |..|. ||..|:.:||| ..::.:..:.|:......|.||.|.:|.:.|.|:|.
Human   283 SLPASAREAFRAGLKV-SFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLD 346

  Fly   349 EDQLYLIEKTGLKRVI--APVWRNMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDI 411
            ||...|::...:.|.:  .|.:||    |.....::.::|::......:||:.|:.||.||.|..
Human   347 EDAAQLLQLLQVDRQLRFPPSYRN----RTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPK 407

  Fly   412 QEYL 415
            .|.|
Human   408 PENL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 68/254 (27%)
CHST12NP_001230723.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..125 9/47 (19%)
Sulfotransfer_2 160..405 CDD:367564 68/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.