DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and Chst13

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001178903.1 Gene:Chst13 / 500257 RGDID:1562825 Length:340 Species:Rattus norvegicus


Alignment Length:319 Identity:97/319 - (30%)
Similarity:147/319 - (46%) Gaps:86/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 MLQVEQRMDQRRERLKDKCSAYGLDVLGHDAWHT--------PNTWEFLVNKKYHIIWCNVFKAA 195
            |.:|.|   ||||.|:..||.           ||        .:....||:.|:.:::|.|.|.|
  Rat    67 MAEVHQ---QRRELLRRACSR-----------HTRRQRLLQPEDLRHVLVDDKHRLLYCYVPKVA 117

  Fly   196 SSSWMFNFNVLAGYSPSYLRKTKKILLNL----------ARERYPRVTLDEL---------REAQ 241
            .::|                  |::||.|          |.|.:....|..|         |..:
  Rat   118 CTNW------------------KRVLLALRGRGDPGAIPAHEAHEPGLLPSLADFAPAEVNRRLR 164

  Fly   242 NYSVTFIIARDPFERLLSAYRDKMVFALPYS--FHDKLGRSIVRNYR--KKPSLAARAANTKFPS 302
            :| :||:..|:|||||.||||:|:  |.|:|  |..:.|..|||..|  .:|...||..:.:   
  Rat   165 DY-LTFLFVREPFERLASAYRNKL--ARPHSAAFQRRYGTRIVRRLRPHAQPDALARGHDVR--- 223

  Fly   303 FPEFVHWLLD-QVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQ---LYLIEKTGLKRV 363
            |.||:.:||| :.:|....:.|:..|.:.|.|||:|:|::.|||:||:|.   |:|:.:.|| |.
  Rat   224 FAEFLAYLLDPRTRRYEPFNEHWERAHALCHPCLVRYDVVGKFETLADDAAFVLHLVGEPGL-RF 287

  Fly   364 IAPVWR-----NMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDIQEYLQV 417
            .||..|     ...:.|:..:....||.:       .|::.||.||.||:|....||::
  Rat   288 PAPPLRPEKDLTRVQARRLFQDISPFYQR-------RLFDLYKMDFLLFNYSAPSYLRL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 80/259 (31%)
Chst13NP_001178903.1 Sulfotransfer_2 103..331 CDD:281554 80/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.