DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and chst10

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_005159945.1 Gene:chst10 / 445322 ZFINID:ZDB-GENE-040808-40 Length:399 Species:Danio rerio


Alignment Length:419 Identity:102/419 - (24%)
Similarity:180/419 - (42%) Gaps:88/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PQQQQQEQQQQPQQHGQFPYPVVRY-------PVLLLNKNKNKDLTVVATGKTKNKWRYVDK--- 116
            |..:|:|:||:     .:.|....|       ||.|....::. |.|.|.|.......:|.|   
Zfish     2 PNAKQKEEQQR-----SYVYRFCTYHRERICQPVCLPTMRRHW-LLVGACGWVLLILMFVSKFIN 60

  Fly   117 --------------------DSNQTLLPLI--PE------HAVQTLTPQEMLQVEQRM--DQRRE 151
                                .|..|.||.:  ||      :.:.:::|..:..::..:  ::|.|
Zfish    61 FSFRIPGDYAGRSEIFVWTLSSVTTKLPSVVWPEKGASQPYILSSVSPSVVEPIDWHLVNEKRLE 125

  Fly   152 RLKDKCSAYGLDVLGHDAWHTPNTW--EFLVNK-----KYHIIWCNVFKAASSSWMFNFNVLAGY 209
            :|...||       ....|:..:|.  :|::::     |:.|::|...|..::.|.....||.| 
Zfish   126 QLSTVCS-------NSSIWNLTHTTVRKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNG- 182

  Fly   210 SPSYLRKTKKILLNLA----RERYPR---VTLDELREAQNYSVTFIIARDPFERLLSAYRDKMV- 266
               ...|.:.|..||.    |...||   :|..|:.:..|....|.|.|||||||:||::||.| 
Zfish   183 ---KFSKVEAIPENLVHDHERNGLPRLSSMTDTEIHQRLNSYFKFFIVRDPFERLISAFKDKFVK 244

  Fly   267 ---FALPYSFHDKLGRSIVRNYRKKPSLAARAANTKFPSFPEFVHWLLDQVKR-------GSFID 321
               |. |:..|| :..:|||.||:.....:.:...:   |.:||.:|.|:..|       |..| 
Zfish   245 NPRFE-PWYKHD-IAPAIVRKYRRSHHDDSESVGLR---FEDFVRYLGDKTGRQHLDRQFGDHI- 303

  Fly   322 MHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTGLKRVIAPVWRNMGKGRKTHELQQQFYA 386
            :|::.....|.||.|.::::...|:|..|..|:::..|:..:::......|..|......:::::
Zfish   304 IHWLTYAELCAPCDISYNVVGHHETLELDAPYILKSAGIAGLVSYPSIPPGITRYNRTKVERYFS 368

  Fly   387 QLTRQEMLELYEYYKYDFELFDYDIQEYL 415
            .::::::..||..|:.||.||||....:|
Zfish   369 GISQRDIRRLYARYQGDFSLFDYPKPAFL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 68/250 (27%)
chst10XP_005159945.1 Sulfotransfer_2 155..391 CDD:281554 68/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.