DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and chst11

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_997989.2 Gene:chst11 / 404232 ZFINID:ZDB-GENE-040315-1 Length:352 Species:Danio rerio


Alignment Length:291 Identity:88/291 - (30%)
Similarity:146/291 - (50%) Gaps:42/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RRERLKDKCSAYGLD-----VLGHDAWHTPNTWEFL-VNKKYHIIWCNVFKAASSSWMFNFNVLA 207
            ||:::.:.|.|:...     ||      ||:..:.| |::.:.:|:|.|.|.|.::|.....||:
Zfish    81 RRDQVAETCHAHSASSRKRRVL------TPSDLKHLVVDEDHELIYCYVPKVACTNWKRVMMVLS 139

  Fly   208 G---YS-----PSYLRKTKKILLNLARERYPRVTLDELREAQNYSVTFIIARDPFERLLSAYRDK 264
            |   ||     ||........|..|.:...|.:.    ...:|| :.|:..|:|||||:||||:|
Zfish   140 GRGKYSNPMEIPSNEAHVPSNLKTLNQYSIPDIN----HRLKNY-LKFLFVREPFERLVSAYRNK 199

  Fly   265 MVFALPYSFHDKLGRSIVRNYRKKPSLAA--RAANTKFPSFPEFVHWLLDQ-VKRGSFIDMHFVA 326
            .......|||.:.|..|||.|||..:..|  ..|:.|   |.||..:|:|. .:|.:.::.|:..
Zfish   200 FTLRYNTSFHKRYGTKIVRRYRKNATTEALQSGADVK---FQEFAEYLVDPGTQREAPLNEHWQT 261

  Fly   327 ATSFCTPCLIRFDMILKFESLAEDQLYLIEKTG----LKRVIAPVWRNMGKG-RKTHELQQQFYA 386
            ..|.|.||.|.:|::.|:|:|.:|..|:::..|    |:      :.:..|. |.|.::...|:.
Zfish   262 VYSLCHPCHIHYDLVGKYETLEDDANYVLKLVGEGDSLR------FPSFAKSTRTTDQMAAMFFG 320

  Fly   387 QLTRQEMLELYEYYKYDFELFDYDIQEYLQV 417
            .::.|:..:||:.||.|:.:|:|.|..||::
Zfish   321 NISSQQQSQLYQLYKLDYLMFNYSIPSYLKL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 74/243 (30%)
chst11NP_997989.2 Sulfotransfer_2 113..343 CDD:281554 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.