DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and Y48G1BL.7

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001021776.2 Gene:Y48G1BL.7 / 3565824 WormBaseID:WBGene00021666 Length:319 Species:Caenorhabditis elegans


Alignment Length:208 Identity:38/208 - (18%)
Similarity:77/208 - (37%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 LARERYPRVTLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYSFHDKLGRSIVRNYRKK 288
            |.:::.....|.::...|..|: |.:.|:|.:|.:|.:.||.           |..::.:.::. 
 Worm   126 LCKDKNEFTELKKIGSWQKMSI-FTVVRNPIDRFVSGFTDKC-----------LRENVWKKFKN- 177

  Fly   289 PSLAARAANTKFPSFPEFVHWLLDQVKRGS--------FIDMHFVAATSFC--TPCLIRFDMI-L 342
                 |.|..| .:...||..:.|::.|.:        |.|.||...:..|  :..|:::.:. |
 Worm   178 -----RCAGCK-TNLTCFVDKMYDRMHRFARNPYKGIDFDDSHFFPQSWRCEFSSHLVKYQIFQL 236

  Fly   343 KFESLAEDQLYLIEKTGLKRVIAPVWRNMGKGRKTHELQQQFYAQLTRQEML-------ELYEYY 400
            ...:.....|.|:.:.|:..............|..|............:.:|       ::.:.|
 Worm   237 DGANFTNQLLGLLSERGVDENGINFINGSLHHRTPHSTMDSVERAAVEETVLSSPYLLRKIIQMY 301

  Fly   401 KYDFELFDYDIQE 413
            .:||.||.|.:.:
 Worm   302 YFDFLLFGYKLPD 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 37/202 (18%)
Y48G1BL.7NP_001021776.2 Sulfotransfer_2 79..310 CDD:281554 37/202 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.