DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and Y87G2A.16

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001021832.1 Gene:Y87G2A.16 / 3565642 WormBaseID:WBGene00013602 Length:356 Species:Caenorhabditis elegans


Alignment Length:383 Identity:68/383 - (17%)
Similarity:123/383 - (32%) Gaps:133/383 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TKNKWRYVDKDSNQTLLPLIPEHAVQTLTPQ--EMLQVEQRMDQRR------------------- 150
            |:|..:.:...::.|:.|  |:      ||:  ::|..|:|..::|                   
 Worm    26 TQNPVKTLINATSSTIKP--PK------TPKFYKILNWEKRESEKRLNNIEALIRANSNKLPNRT 82

  Fly   151 ---------ERLKDKCSAYGLDVLGHDAWHTPNTWEFLVNKKYHIIWCNVFKAASSSWMFNFNVL 206
                     .:|:..|.....|..|          |...:.:|::..|.|.|:.|:.....|   
 Worm    83 SNLSAVQLCSKLRSPCLPALKDFEG----------EIRTSPRYNLSTCVVQKSMSTVMTSMF--- 134

  Fly   207 AGYSPSYLRKTKKILLN----LARERYPRVTL--DELRE------------AQNYSVTFIIARDP 253
                 .|||..||.:.|    |...:..|..:  :|.|.            |.|.....::.|.|
 Worm   135 -----CYLRDEKKFVGNHRELLKDWKIVRFCMFKNEFRNLGGVFKKFKIPPAPNNWTHIMMVRHP 194

  Fly   254 FERLLSAYRDKMVFALPYSFHDKLGRSIVRNYRKKPSLAARAANTKFPSFPEF-VHWLLDQVKRG 317
            |||.:|.:.||.           ..:.:::.|       ..........|.|. :..:..||:.|
 Worm   195 FERFVSGFVDKC-----------YRKPVIQKY-------CNGCGRNLTCFMETELKRMGQQVESG 241

  Fly   318 SF----IDMHFVAATSFCT--PCLIRFDMILKFESLAEDQLYLIEKTGLKRVIAPVWR------- 369
            .|    .|.||...:..|.  .....|..||...|         ....:...:.|::|       
 Worm   242 KFQRTYEDRHFFPQSWRCNLHQYFSNFTFILYSSS---------HNFSITSQLFPIFRQHSVPQS 297

  Fly   370 -------NMGKGRKTHE---------LQQQFYAQLTRQEMLELYEYYKYDFELFDYDI 411
                   ::..||..|.         ::::..:.....|:  |.:.:.:||.||::.:
 Worm   298 SLDFIETSLSAGRTAHSTVDSKATSFIEKRLNSSPYLMEL--LVKMFYHDFVLFNFTL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 52/275 (19%)
Y87G2A.16NP_001021832.1 Sulfotransfer_2 112..351 CDD:281554 52/275 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.