DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and CG14024

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001260094.1 Gene:CG14024 / 33760 FlyBaseID:FBgn0031697 Length:444 Species:Drosophila melanogaster


Alignment Length:435 Identity:140/435 - (32%)
Similarity:215/435 - (49%) Gaps:62/435 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RAIRRYLLIFTAVSLLLLPLSLAYLVWNEQLQKIRGFE-AFNVQQQSPQQPQPQQQQQEQQQQPQ 74
            |.::.||.|...|   |:.|.....::.|.|......| |...:.::..:|..||.:.::||..:
  Fly     9 RRLQTYLKIGACV---LVGLCYFAFLFRESLNAYEHRERATAAELEAESEPSKQQLKLKRQQLQR 70

  Fly    75 QHGQFPYPVVRYPVLLLNKNKNKDLTVVATGKTKNKWRYVDKDSNQTLLPLIPEHAVQTLTP--- 136
            |.           :|...:.:.|.   :|.|...     ....|:|...|..|..|. ||.|   
  Fly    71 QR-----------ILAKQQEQGKG---IAGGNAS-----AGSSSSQAAAPPPPPPAT-TLNPVYE 115

  Fly   137 --QEM-LQVEQRMDQRRERLKDKCSAYGLDVLGHDAWHTPNTWEFLVNKKY-HIIWCNVFKAASS 197
              :|: .:.|:.:.:|.|.|...|..|.|     ...:.||.|||.|:..: :::||||||||||
  Fly   116 YSEELHSRTERELQRRSEHLAAVCDRYKL-----QEKYPPNPWEFFVSPGHNNLVWCNVFKAASS 175

  Fly   198 SWMFNFNVLAGYSPSYLRKTKKILLNLARERYPRVTLDELREAQNYSVTFIIARDPFERLLSAYR 262
            :||:.||:||||...||::|:...|.|||:|:||..|.||.|....:::|:..||||||:|||||
  Fly   176 TWMYYFNILAGYDVKYLQRTETQPLELARKRFPRPELGELMELLPSALSFLFVRDPFERILSAYR 240

  Fly   263 DKMVFALPYSFHDKLGRSIVRNYRKK------PSLAARAANTKFPSFPEFVHWLLDQVKRGSFID 321
            :|:. ....:|:..||..||..|||:      |...        |:|.|||.:|:.:...|...|
  Fly   241 NKLE-GNKNTFYKALGNKIVHRYRKRNLGGPWPRCG--------PTFEEFVRFLIAEHAAGKRFD 296

  Fly   322 MHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTGLKRVIAPV-------WRNMG----KGR 375
            .|:....||||||.:.|.:|.|.|:...|..::|.:.||:.::..:       .|.:|    .|.
  Fly   297 EHWAPVYSFCTPCSVNFTIIGKTETFQRDSEFIIRQAGLESLLLGLGKLPQRKQRKIGNQARSGV 361

  Fly   376 KTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDIQEYLQVARP 420
            |:..|.::::|.|.|..:.:|.:.|:.||||||||.:.|..:..|
  Fly   362 KSEALVERYFADLDRSTLDQLLKIYRIDFELFDYDYRRYYDMVHP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 92/245 (38%)
CG14024NP_001260094.1 Sulfotransfer_2 160..395 CDD:281554 92/243 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116230at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.