DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and T09E11.3

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_493131.1 Gene:T09E11.3 / 188331 WormBaseID:WBGene00011652 Length:305 Species:Caenorhabditis elegans


Alignment Length:207 Identity:42/207 - (20%)
Similarity:78/207 - (37%) Gaps:49/207 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 RVTLDE------LREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYSFHDKLGRSIVRNYRKKP 289
            |..:||      |......:|.|...|||.:|.:|.|.||.|  .....:| .|.:::....|..
 Worm    95 RNCMDEFKFIHPLEPIHKGTVKFAFIRDPLQRFVSFYLDKCV--RENRCYD-CGSNMICIVEKVY 156

  Fly   290 SLAARAANTKFPSFPEFVHWLLDQVKRGSFIDMHFVAATSFCTPC----------LIRFDMILKF 344
            |...:..|:          |  |......:::.|   |......|          ||........
 Worm   157 SNLKKIQNS----------W--DGTSELGYVERH---AAPMSWNCNFHKGLDSWELIPIGSDANE 206

  Fly   345 ESLAEDQLY-LIEKTGLKRVIAPVWRNMGKGRKTHELQQQFYAQLTR----QEMLE-------LY 397
            .::|.::|. |::|.|:.:.:.   ..:.:|.||.|.:...::...|    :::.|       |:
 Worm   207 RTIAIERLSGLLKKQGVNQTLI---EKVQEGMKTGETEHSTHSSTGRIKAERQVREDPYIQNLLH 268

  Fly   398 EYYKYDFELFDY 409
            :.|.:|:.:|.:
 Worm   269 KIYFFDYLVFPF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 42/205 (20%)
T09E11.3NP_493131.1 Sulfotransfer_2 49..280 CDD:281554 42/205 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.