DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and K06H6.5

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_503250.1 Gene:K06H6.5 / 187074 WormBaseID:WBGene00019453 Length:339 Species:Caenorhabditis elegans


Alignment Length:281 Identity:57/281 - (20%)
Similarity:102/281 - (36%) Gaps:60/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 EFLVNKKYHIIWCNVFKAASSSWMFNFNVLAGYSPSYLRKTKKILL------------NLARERY 229
            ::::.:.|::..|.|.|:.|   ....|::...|.:.|.:.:...|            |:|...|
 Worm    78 DYVITENYNLHACIVRKSMS---QLTTNLMCYLSNTALYEDRNRTLSDTWAARKGSCDNIAWSAY 139

  Fly   230 -PRVTLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALP-YSFHD-----KLGRSIVRNYRK 287
             |......:..::...:.||  |.|..|.:|.:.||.:.... |...|     ||....:.|:.:
 Worm   140 APLYENGTMSMSRMTKLAFI--RHPESRFVSFFVDKCINTNSCYGCRDLHCAVKLVYDRLMNHVQ 202

  Fly   288 KPSLAARAANT----KFPSFPEFVHWLLDQVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLA 348
            ...|..::.:.    .:.:.|:  .|..|..|.  ..|.|           ||:.....|...||
 Worm   203 NRHLIDQSESELWWFDWHAAPQ--TWNCDFYKH--LTDYH-----------LIKIGTSQKDRKLA 252

  Fly   349 EDQLYLIEKTG------LKRVIAPVWRNMGKGRKTHE-------LQQQFYAQLTRQEMLELYEYY 400
            ..||.:..||.      :::::|....:..| ..||:       |||.......|.   .|:..|
 Worm   253 MKQLQIALKTANVEDKYIEKIMADTLVSDTK-HGTHQSKSNLRILQQVRTDPYVRH---YLHRIY 313

  Fly   401 KYDFELFDYDIQEYLQVARPD 421
            .:|:..|.::|.|......|:
 Worm   314 YFDYVAFGFEIPEVYSADLPE 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 54/263 (21%)
K06H6.5NP_503250.1 Sulfotransfer_2 82..322 CDD:281554 54/263 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.