DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and F59D12.3

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_510579.2 Gene:F59D12.3 / 186618 WormBaseID:WBGene00010331 Length:318 Species:Caenorhabditis elegans


Alignment Length:269 Identity:53/269 - (19%)
Similarity:94/269 - (34%) Gaps:56/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 HTPNTWEFLVNKKYHIIWCNVFKAASSSWMFNFNVLAGYSPSYLRKTKKILL-----NLARERYP 230
            :.|....|:.:.||.:..|.:.|..|:..:..|..|  .:|....||...|.     :::.|...
 Worm    65 YVPFRSTFVTSPKYSLAACRIQKNLSTILLNLFCFL--NTPRKFSKTGNSLTVEFRNHISVETCN 127

  Fly   231 RVTLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYSFHDKLGRSIVRNYR-----KKPS 290
            :...:.:.....::....|.|||.||.||.:.||.:       |:    :..::||     |...
 Worm   128 KTHANHIAMNTTFTTKLAIIRDPVERFLSGFVDKCI-------HE----AEKKDYRCYGCNKDMV 181

  Fly   291 LAARAANTKFPSFPEFVHWLLDQVKRGSFIDMHFVAATSFCTPCLIRFD-------MILKFESLA 348
            ...:....:|....|      .::...|:.|.||...:.||.     ||       ..|.|....
 Worm   182 CVLKEQYERFKLIAE------GRLLSFSYEDRHFAPMSWFCD-----FDSETIKNYRFLFFGETE 235

  Fly   349 EDQLYLIEKT-------GLKR-VIAPVWRNMGKGRKTHELQQQFYAQLTRQEMLE-------LYE 398
            |.|...|.:.       |:.. .|:.:::.:...|..|........:...:||..       |:.
 Worm   236 EKQSQTIRELMNIFSVHGVDNGTISHIFQELSANRTKHSTSGSAIREKIGKEMRSDPEAMRLLHL 300

  Fly   399 YYKYDFELF 407
            .|:.|:.:|
 Worm   301 IYENDYRIF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 51/259 (20%)
F59D12.3NP_510579.2 Sulfotransfer_2 75..309 CDD:281554 50/257 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.