DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and F56H6.4

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_493105.1 Gene:F56H6.4 / 186415 WormBaseID:WBGene00010165 Length:316 Species:Caenorhabditis elegans


Alignment Length:203 Identity:39/203 - (19%)
Similarity:73/203 - (35%) Gaps:71/203 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 SVTFIIARDPFERLLSAYRDKMVFALP-YSFHDKLGRSIVRNYRKKPSLAARAANTKFPSFPEFV 307
            :|.|...||||:|.:|.|.||.|.... |:..:.: ..:::|:                      
 Worm   131 TVRFAFIRDPFQRFISFYLDKCVREQKCYNCGNNM-TCVLKNF---------------------- 172

  Fly   308 HWLLDQVKR-------GSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQLYLI--EKTGLKRV 363
            :|.|.:|:|       ..::::|....:..|       |.   ::.|::.||..|  :||.....
 Worm   173 YWGLKKVQRRWDGREQPEYVEIHAAPLSWNC-------DF---YKDLSKWQLIPIGSDKTERSSA 227

  Fly   364 IAPVWRNMGK-------------GRKTHELQQQFYAQLTR-------------QEMLELYEYYKY 402
            |....:.:.|             |.|..:.....|....|             :||  |::.|.:
 Worm   228 ITQTEKILRKQRVNETLVDMVVDGMKDGDTDHSTYKSAHRLEAERQIREDPYIREM--LHKIYYF 290

  Fly   403 DFELFDYD 410
            |:.:|.::
 Worm   291 DYVVFPFN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 39/200 (20%)
F56H6.4NP_493105.1 Sulfotransfer_2 64..297 CDD:281554 39/200 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.