DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and F49D11.6

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_492843.2 Gene:F49D11.6 / 186035 WormBaseID:WBGene00018630 Length:314 Species:Caenorhabditis elegans


Alignment Length:275 Identity:67/275 - (24%)
Similarity:97/275 - (35%) Gaps:81/275 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 FLVNKKYHIIWCNVFKAASSSWMFNFNVLAGYSPSY------LRKTKKILLN-LARE---RYPRV 232
            |....||.:|.|.:.|:.:...| |...|......|      |..|.||... ||.|   .||..
 Worm    60 FYTAPKYKLISCGLRKSMTQLTM-NLMCLLYNEQQYFEDNNSLNDTWKIKRRCLADEYNFYYPTK 123

  Fly   233 TLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYSFHD----KLG---RSIVRN-YRKKP 289
            .|....|    :|.|...|||.:|.:|.|.||.|       |:    |.|   |.||.| |.|..
 Worm   124 ALKNDLE----TVRFAFIRDPIQRFVSLYLDKCV-------HEKRCYKCGTDMRCIVENIYLKLK 177

  Fly   290 SL----------------AARAANTKFPSFPEFVHWLL-----DQVKRGSFIDMHFVAATSFCTP 333
            ::                |..:.|.:|.:  :...|.|     |..:|.|.| :|...       
 Worm   178 AVQENQDNITVTYMEGHAAPLSWNCEFNT--DLSKWQLLMMGADSYERNSSI-LHLTT------- 232

  Fly   334 CLIRFDMILKFESLAEDQLYLIEKTGLKRVIAPVWRNMGKGRKTHELQQQFYA--QLTRQEMLE- 395
                   |||...:.|.   |:||.....:....      |..||:..::..|  |:.....:. 
 Worm   233 -------ILKKRGVNET---LVEKIQQDMIAGET------GHSTHKSAERIEAERQVREDPFIRD 281

  Fly   396 -LYEYYKYDFELFDY 409
             |::.|.:|:.:|.:
 Worm   282 LLHKIYFFDYVVFPF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 66/270 (24%)
F49D11.6NP_492843.2 Sulfotransfer_2 63..296 CDD:281554 66/270 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.