DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and F01D5.10

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_496940.1 Gene:F01D5.10 / 184059 WormBaseID:WBGene00008500 Length:347 Species:Caenorhabditis elegans


Alignment Length:344 Identity:55/344 - (15%)
Similarity:117/344 - (34%) Gaps:103/344 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLSKSLANCRAIRR----YLLIFTAVSLLLLPLSLAYLVWNEQLQKIRGFEAFNVQQQSPQQPQP 62
            ::|.:|.:.:..||    |||:...:::.|  :..||..|                 ::|.|.|.
 Worm    33 RMSSTLQHVQPPRRSNHAYLLVPFVITVGL--MWFAYSQW-----------------KNPPQAQL 78

  Fly    63 QQQQQEQQQQPQQ---------------------------------HGQFP------YPVVRYPV 88
            |......:.:|:.                                 :|.||      :..:....
 Worm    79 QPSVVTDRYRPRVAWMSDLIKSLPPFAQGYRAEKFVPKYKLSGCTINGNFPEMNTAIFCYLYNST 143

  Fly    89 LLLNKNKNKDLTVVATGK-------TKNKWRYVDKDSNQTLLPLIPEHAVQTL--TPQEMLQVEQ 144
            |..:.||.....:..||.       ..|.|:..||.::.....:..:|.::..  :.:::.::|:
 Worm   144 LYTSANKTISQDIGETGLCSKIAEFNMNDWKLWDKINDDFRRIVFIQHPLERFVRSYKKLCKIER 208

  Fly   145 RMDQRRERL---------KDKCSAYGLD------VLGHDAWHTPNTWEFLVNKKYHIIWCNVFKA 194
            :....::.|         :.:.:|.||.      :..|   .:|.||....|:::..|  ...|.
 Worm   209 KCFNCQDNLSCFMRKLLKQHEKTAEGLAGPVRTFITNH---FSPQTWNCHFNREFQKI--RTVKI 268

  Fly   195 AS-----SSWMFNFNVLAGYSPSYLRKTKKILLNLARERYPRVTLDELREAQNYSVTFIIARDPF 254
            ..     :.:..|.|.:.| .....::.::|:    :|...::.|:...:.:..:|......|..
 Worm   269 GGNQTERAEFSDNLNEILG-EQGVAQEVQRII----KEEVLKIPLELSPDERELAVAIKRDHDDL 328

  Fly   255 ERLLSAY--RDKMVFALPY 271
            .||....  .|.:||..|:
 Worm   329 YRLFRYLYEHDFIVFGYPF 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 17/98 (17%)
F01D5.10NP_496940.1 Sulfotransfer_2 115..345 CDD:304664 38/239 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.