DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and C18B2.2

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001379697.1 Gene:C18B2.2 / 182766 WormBaseID:WBGene00015953 Length:356 Species:Caenorhabditis elegans


Alignment Length:302 Identity:60/302 - (19%)
Similarity:105/302 - (34%) Gaps:101/302 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 LGHDAWHTPNTWEFLVNKKYHIIWCNVFKAASS----SWMFNFNVLAGYSPSYLRKTKKILLNLA 225
            |.|:.       .:.|...|.:..|.|.|:.|:    .|.:.||                     
 Worm   101 LNHET-------RYRVAPDYKMAHCVVHKSMSTVITGIWCYLFN--------------------- 137

  Fly   226 RERYPRV-------------------TLDELREAQ-NYSVT-------FIIARDPFERLLSAYRD 263
            |.|:.||                   |...|:..| .|:.:       .:|.|||.:|.:|.|.|
 Worm   138 RNRFVRVDKQMNMSEWDKESLCRGDNTFRHLKSLQKKYNASEMTGWSLSMITRDPIDRFISGYVD 202

  Fly   264 KMVFAL----PYSFHDK-LGRSIVRNYRKKPSLAARAANTKFPSFPEFVHWLLDQVKRGSFIDMH 323
            :.:...    |.:..|| :...|:..|.:....|.:...|                  .:|.|.|
 Worm   203 RCIRVAEGPSPCNGCDKNMTCFILSEYERFKKQAHKGVLT------------------NTFEDRH 249

  Fly   324 FVAATSFCTPCLIR--FDMILKFES-----LAEDQLYLIEKTGL-KRVIAPVWRNMGKGRKT--- 377
            |......|....:|  ::.| ::.|     |.||...:..:.|: ::.:..:...:.|.|||   
 Worm   250 FYPQNWRCDIKTMRNKYEFI-RYSSDASKELMEDLFKIARRQGIPEKELEYIENELTKNRKTSHT 313

  Fly   378 --HELQQQFYAQLTRQEMLELYEY----YKYDFELFDYDIQE 413
              :...::|:.:..|:..| |.||    :.:||.:.:|.:.|
 Worm   314 TAYSPAREFFQRRLRESPL-LMEYVVRMFYHDFVILNYPLPE 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 55/280 (20%)
C18B2.2NP_001379697.1 Sulfotransfer_2 110..350 CDD:397568 55/280 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.