DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and F17B5.4

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001361849.1 Gene:F17B5.4 / 173184 WormBaseID:WBGene00008908 Length:309 Species:Caenorhabditis elegans


Alignment Length:216 Identity:43/216 - (19%)
Similarity:80/216 - (37%) Gaps:59/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 DELREAQN--YSVTFIIARDPFERLLSAYRDKMVFALP-YSFHDKLGRSIVRNYRKKPSLAARAA 296
            |.....||  .:|.|.|.:|||:|.::.|.:|.|.... |.....: |.:|:....  |||....
 Worm   109 DPSESVQNDKDTVRFAILKDPFQRFVTLYLNKCVEKNECYDCGSDM-RCVVKKLYN--SLAEIQN 170

  Fly   297 NTKFP-----------------SFPEFVH-WLLDQVKRGSFIDMHFVAATSFCTPCLIRFDMILK 343
            ||...                 :|.|.:. |.|  ::..|.::....||.             :.
 Worm   171 NTNTTLVIGDIETEAAPISWNCNFHEGIEKWKL--MRMSSDLEKRISAAA-------------VL 220

  Fly   344 FESLAEDQLYLIEKTGLKRVIAP------VWRNMGKGRKTHELQQQFYAQLTRQEMLE--LYEYY 400
            .|.|.|.        |:|:.:..      |:.::....:|...:.:...|:...:::.  |::.|
 Worm   221 LERLREQ--------GVKQAVFMRIHNDIVYNDIANTTQTSNKRDEAEKQVREDQIVRHFLHKIY 277

  Fly   401 KYDFELFDYDIQ----EYLQV 417
            ..|:.:|.:|.:    ||.::
 Worm   278 LMDYLVFRFDRRVLDPEYKKI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 40/202 (20%)
F17B5.4NP_001361849.1 Sulfotransfer_2 52..286 CDD:367564 40/202 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.