DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and ZK1025.2

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_492924.1 Gene:ZK1025.2 / 173030 WormBaseID:WBGene00014182 Length:301 Species:Caenorhabditis elegans


Alignment Length:301 Identity:59/301 - (19%)
Similarity:111/301 - (36%) Gaps:87/301 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TLTPQEMLQVEQRMDQRRERLKDKCSAYGLDVLGHDAWHTPNTWEFLVNKKYHIIWCNVFKAASS 197
            |....:::..|.|....:..|...|..|.......|..:..||||           .:..|..|.
 Worm    43 TAPDNKLIACEIRKSMSQLTLNMMCLLYNETQYLQDKNNFTNTWE-----------TSTRKCTSE 96

  Fly   198 SWMFNFNVLAGYSPSYLRKTKKILLNLARERYPRVTLDELREAQNYSVTFIIARDPFERLLSAYR 262
            :   ||     .:||                      |.|:..:: :|.|:..||||.|.:|.|.
 Worm    97 T---NF-----VTPS----------------------DSLKNDKD-AVRFVFVRDPFRRFVSMYL 130

  Fly   263 DKMVFALPYSFHDKLGRSIVRNYRKKPSLAARAANTKFPSFPEFVHWLLDQVKRG--SFIDMHFV 325
            :|.|.       :|      |.:..:..:...|..| :.||.|..:   ::.|..  .:::.|..
 Worm   131 NKCVV-------EK------RCFDCETDMRCIAKKT-YESFVEIQN---NETKAAGIEYVEAHAA 178

  Fly   326 AATSFCTPCLIRFD------MILKFESLAEDQLY-------LIEKTGLK-RVIAPVWRNM---GK 373
            ..|..|     :|:      .:|..:|..:|::.       ::.|.|:: .::..:::::   ..
 Worm   179 PTTWNC-----KFNEGVENWELLPMDSDLKDRISSAAKLADILRKQGVRDTLVEQIYKDILTTET 238

  Fly   374 GRKTHELQQQFYAQLTRQEMLELYEY----YKYDFELFDYD 410
            ...||:..::..|:...:|...:.||    |.||:.||.:|
 Worm   239 AHSTHKWTKRLEAEKQVREDPIVREYLHKIYLYDYLLFPFD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 47/250 (19%)
ZK1025.2NP_492924.1 Sulfotransfer_2 44..278 CDD:281554 57/297 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.