DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and CHST13

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_690849.1 Gene:CHST13 / 166012 HGNCID:21755 Length:341 Species:Homo sapiens


Alignment Length:311 Identity:86/311 - (27%)
Similarity:139/311 - (44%) Gaps:61/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 PQEMLQVEQRMDQRRERLKDKCSAYGLD---VLGHDAWHTPNTWEFLVNKKYHIIWCNVFKAASS 197
            |:..|....|  |||:.|...||.:...   :...|..|.      ||:..:.:::|.|.|.|.:
Human    62 PRSTLAKVHR--QRRDLLNSACSRHSRRQRLLQPEDLRHV------LVDDAHGLLYCYVPKVACT 118

  Fly   198 SWMFNFNVLAGYSPSYLRKTKKILLNL------------ARERYPRVTLDEL---------REAQ 241
            :|                  |::||.|            |:|.:....|..|         |..:
Human   119 NW------------------KRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLR 165

  Fly   242 NYSVTFIIARDPFERLLSAYRDKMVFALPYS--FHDKLGRSIVRNYRKK--PSLAARAANTKFPS 302
            .| :.|:..|:|||||.||||:|:  |.|||  |..:.|..||:..|.:  |...||..:.:   
Human   166 AY-LAFLFVREPFERLASAYRNKL--ARPYSAAFQRRYGARIVQRLRPRALPDARARGHDVR--- 224

  Fly   303 FPEFVHWLLD-QVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTGLKRVIAP 366
            |.||:.:||| :.:|....:.|:..|.:.|.||.:|:|::.|||:||||..:::...|...:..|
Human   225 FAEFLAYLLDPRTRREEPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFP 289

  Fly   367 VWRNMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDIQEYLQV 417
            ..........:.:|..:.:..::......|::.||.||.||:|....||::
Human   290 GPPRPRGAAASRDLAARLFRDISPFYQRRLFDLYKMDFLLFNYSAPSYLRL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 70/253 (28%)
CHST13NP_690849.1 Sulfotransfer_2 102..332 CDD:281554 70/253 (28%)
Cell attachment site. /evidence=ECO:0000255 132..134 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.