DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and Chst10

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_006244792.1 Gene:Chst10 / 140568 RGDID:621216 Length:374 Species:Rattus norvegicus


Alignment Length:328 Identity:79/328 - (24%)
Similarity:146/328 - (44%) Gaps:52/328 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LPLIPE--------HAVQTLTPQEMLQVEQRMDQ------RRERLKDKCSAYGLDVLGHDAWHTP 173
            |..:||        |..:.:.|...:..|...||      |.|.:::.|....|..|.|     .
  Rat    62 LTAMPEAEKLRGEKHFSEVMKPTGKMLSESHPDQPPVYLERLELIRNACKEEALRNLSH-----T 121

  Fly   174 NTWEFLVNK-----KYHIIWCNVFKAASSSWMFNFNVLAGYSPSYLRKTKKILLNLARERYPRVT 233
            ...:|::::     |:.|::|...|..::.|.....||.|...|.....:.::.:..:...||::
  Rat   122 EVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIPENVVHDHEKNGLPRLS 186

  Fly   234 ----LDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYS--FHDKLGRSIVRNYRKKPSLA 292
                :...:..:.| ..|.|.|||||||:||::||.|....:.  :..::...|:|.|||     
  Rat   187 SFSKIGIQKRLKTY-FKFFIVRDPFERLISAFKDKFVHNPRFEPWYRHEIAPGIIRKYRK----- 245

  Fly   293 ARAANTKFPSFPEFVHWLLDQVKR------GSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQ 351
             ....|:...|.:||.:|.|..:|      |..| :|:|.....|.||.|::.:|...|:|..|.
  Rat   246 -NRTETRGIQFEDFVRYLGDPNRRWLDLQFGDHI-IHWVTYVKLCAPCEIKYSVIGHHETLEADA 308

  Fly   352 LYLIEKTGLKRVIA----PVWRNMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDIQ 412
            .|::::.|:..:::    |....|....|.    :|::..::::::..||..::.||:||.|...
  Rat   309 PYILKEAGIDHLVSYPTIPPGITMYNRTKV----EQYFLGISKRDIRRLYARFEGDFKLFGYQKP 369

  Fly   413 EYL 415
            ::|
  Rat   370 DFL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 62/248 (25%)
Chst10XP_006244792.1 Sulfotransfer_2 134..366 CDD:281554 62/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.