DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and B0273.115

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001255272.1 Gene:B0273.115 / 13194168 WormBaseID:WBGene00206473 Length:127 Species:Caenorhabditis elegans


Alignment Length:105 Identity:19/105 - (18%)
Similarity:38/105 - (36%) Gaps:10/105 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 FIDMHFVAATSFC--TPCLIRFDMI-LKFESLAEDQLYLIEKTGLKRVIAPVWRNMGKGRKTHEL 380
            |.|.||...:..|  :..|:::.:. |...:.....|.|:.:.|:.......:......|..|..
 Worm    18 FDDSHFFPQSWRCEFSSHLVKYQIFQLDGANFTNQLLGLLSERGVDENGINFFNGSLHHRTPHST 82

  Fly   381 QQQFYAQLTRQEML-------ELYEYYKYDFELFDYDIQE 413
            ..........:.:|       ::.:.|.:||.||.|.:.:
 Worm    83 MDSVERAAVEETVLSSPYLLRKIIQMYYFDFLLFGYKLPD 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 18/99 (18%)
B0273.115NP_001255272.1 Sulfotransfer_2 <1..118 CDD:304664 18/99 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.