DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and chst9l.4

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_012825151.2 Gene:chst9l.4 / 101730847 XenbaseID:XB-GENE-22169235 Length:298 Species:Xenopus tropicalis


Alignment Length:254 Identity:63/254 - (24%)
Similarity:107/254 - (42%) Gaps:57/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 VNKKYHIIWCNVFKAASSSWMFNFNVLAGYSPSYLRKTKKIL----LNLARE------------- 227
            |.:|:..|.|.|.|...::|                  |:|:    |||:.|             
 Frog    77 VEQKHKFIICAVPKVGCTNW------------------KRIILLLKLNLSTEVHFEHNAIHESAF 123

  Fly   228 -----RYPRVTLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYSFHDKLGRSIVRNYRK 287
                 .||   .|:.|.........:..|.||:|::||||||  |..|..::..:...|....||
 Frog   124 LKRLSDYP---ADQQRMMLTNYTKVMFTRHPFQRIVSAYRDK--FLHPGDYYKHIANIIKSQVRK 183

  Fly   288 KPSLAARAANTKFP-SFPEFVHWLLDQVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQ 351
                    .||..| :|.|||.:::.||.  :::|:|::.....|.||.|.::::.|||:|..|.
 Frog   184 --------VNTPEPVTFKEFVQYIVQQVP--TWLDIHWMPMHLLCDPCNINYNILGKFETLKRDS 238

  Fly   352 LYLIEKTGL-KRVIAPVWRNMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDY 409
            ..:::..|. ..:..|..:...:.|....:..::::.|....:..|.:.|.:||.||.|
 Frog   239 DQVLKTIGAPSNLKYPELKQYNESRTDTNIVDKYFSTLPLNVLDLLVKLYNHDFMLFGY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 61/251 (24%)
chst9l.4XP_012825151.2 Sulfotransfer_2 80..297 CDD:397568 61/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.