DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and LOC100536144

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_021326538.1 Gene:LOC100536144 / 100536144 -ID:- Length:345 Species:Danio rerio


Alignment Length:325 Identity:92/325 - (28%)
Similarity:151/325 - (46%) Gaps:56/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 HAVQTLTPQEMLQVEQRMDQRRERLKDKCSA----------YGLDVLGHDAWHTPNTWEFLVNKK 183
            |...:..|..:   ::|...|:.|:::.|:|          :..|.:...:.:     ..:|:..
Zfish    36 HMASSKDPTHL---KRRQAHRKHRIRELCAANSSLHFKEKSFTFDQIPDSSLN-----NLIVDDH 92

  Fly   184 YHIIWCNVFKAASSSW---MF--NFNVLAGYSPSYL----------------RKTKKILLNLARE 227
            :.:|:|.|.|.|.::|   ||  :.|:.|.....||                ...||:.:.  ..
Zfish    93 HRVIYCYVPKVACTNWKRVMFALSQNLKAPDGAPYLDPLDIPLEIIHNSTVHNTFKKLWMR--HG 155

  Fly   228 RYPRVTLDELREAQNYSVTFIIARDPFERLLSAYRDKMVFALPYSFHDKLGRSIVRNY---RKKP 289
            ||.|..:::  :.:||: .|:..||||.||:||||||.|....|.:.| .|..|::.|   .:.|
Zfish   156 RYARPLMEQ--KLKNYT-KFLFVRDPFVRLISAYRDKFVELNEYYYSD-FGSMILQRYANISQPP 216

  Fly   290 SLAARAANTKF-PSFPEFVHWLLD-QVKRGSFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQL 352
            :.|..|..... |||..|:.:||| |.::....|.|:......|.||.|.:|.|.|.|:|.||..
Zfish   217 TSAQEAFRAGIRPSFTHFIKYLLDPQTEKEEPFDEHWQQIHRLCHPCQIDYDFIGKLETLDEDTE 281

  Fly   353 YLIEKTGLKRVI--APVWRNMGKGRKTHELQQQFYAQLTRQEMLELYEYYKYDFELFDYDIQEYL 415
            :|::..||.:.|  .|.:.|    |...:.:|:::|.::..:..|||..|:.||:||.||..|.|
Zfish   282 HLLKILGLDKHIHFPPGYEN----RTAVDWEQEWFANISLADRRELYSLYETDFKLFGYDKPETL 342

  Fly   416  415
            Zfish   343  342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 79/255 (31%)
LOC100536144XP_021326538.1 Sulfotransfer_2 90..336 CDD:308913 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.