DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and chst14

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_004917361.1 Gene:chst14 / 100496179 XenbaseID:XB-GENE-1008667 Length:371 Species:Xenopus tropicalis


Alignment Length:301 Identity:91/301 - (30%)
Similarity:131/301 - (43%) Gaps:48/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 EMLQVEQRM--DQRRERLKDKCSAYGLDVLGHDAWHTPNTW------EFLVNKKYHIIWCNVFKA 194
            |..::|..:  |.|...|:..|:...:.   |..|..|.:.      ..||:.||..::|.|.|.
 Frog    92 ESAEMEHHILRDIRNRTLRSVCAQRNMP---HSIWQLPASQRRTLLKHILVSDKYRFLYCYVPKV 153

  Fly   195 ASSSWMFNFNVLAGYSPSYLRKTKK-------ILLNLARERYPRVTLDELREAQNYSVTFIIARD 252
            |.|:|.....||.|..||...|.|.       .|.:|:.|        |:|....:...|:..|:
 Frog   154 ACSNWKRVLKVLGGSLPSTDVKLKMDHKSDLVFLADLSAE--------EVRYRLRHYYKFMFVRE 210

  Fly   253 PFERLLSAYRDKMVFALPYSFHDKLGRSIVRNYRKKPSLAARAANTKFPSFPEFVHWLLDQVKRG 317
            |.||||||||:|  |.....:..:.|..|:|.|||:...:|....|    ||||:|:|||:....
 Frog   211 PMERLLSAYRNK--FGEIKEYQQRYGVEIIRRYRKQGGSSAGDDVT----FPEFLHYLLDEDPER 269

  Fly   318 SFIDMHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTGLKRVIAPVW-----RNMGKGRKT 377
              ::.|::...:.|.||.:.:|.|..:|.|.||..|:     |:||.||.:     |.......|
 Frog   270 --MNEHWMPIYNLCQPCALTYDFIGSYERLREDANYV-----LQRVKAPPFIQFPERQAWYKPVT 327

  Fly   378 HELQQQFYAQLTRQEMLELYEYYKYDFELFDYDI----QEY 414
            .|.|..|.....:..:.||...|..||.||.|.:    .||
 Frog   328 RESQDYFLCNTPKGLIRELLPKYIMDFSLFAYPLPNITSEY 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 77/239 (32%)
chst14XP_004917361.1 Sulfotransfer_2 140..359 CDD:367564 77/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.