DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and chst9l.1

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_012824242.2 Gene:chst9l.1 / 100486378 XenbaseID:XB-GENE-22169229 Length:294 Species:Xenopus tropicalis


Alignment Length:294 Identity:66/294 - (22%)
Similarity:121/294 - (41%) Gaps:69/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 DQRRERLKDKC-------SAYGLDVLGHDAWHTPNTWEFLVNKKYHIIWCNVFKAASSSWMFNFN 204
            :|||:.:...|       |.:|:...      |.|  :..|...:..|:|.|.|...|:|     
 Frog    35 NQRRDTVSYICRQNNFTDSLHGISST------TAN--QLYVVHDHKFIYCEVPKVGCSNW----- 86

  Fly   205 VLAGYSPSYLRKTKKILLNLARERYPRVTLD-----ELREAQNYS-----------VTFIIARDP 253
                         |:|:|.|.|.....|..|     .|::..:||           .|.:..|.|
 Frog    87 -------------KRIILLLNRTGGKFVPQDVHTSPYLKKLSSYSPAEQVALLKNYTTVMFTRHP 138

  Fly   254 FERLLSAYRDKMVFALPYSFHDKLGRSIVRNYRKKPSLAARAANTKFPSFPEFVHWLLDQVKRGS 318
            .|||:||||||.:......:...:...|.:..|:......:.      ||.|||.:::  ::..:
 Frog   139 LERLVSAYRDKFLHDEATFYTTSVADLIKKTVRRHGDFEEKI------SFEEFVSFIV--LENPN 195

  Fly   319 FIDMHFVAATSFCTPCLIRFDMILKFESLAEDQLYLIEKTGLKRVIAP-------VWRNMGKGRK 376
            ..|:|::.....|.||.|.:|::.|::::.:|..|:     |:.:.||       ...:..:.|.
 Frog   196 QRDIHWMPMVELCDPCNIHYDILGKYKTIKQDAAYV-----LRSIRAPKHLKYSDTKHHPNESRT 255

  Fly   377 THELQQQFYAQLTRQEMLELYEYYKYDFELFDYD 410
            .:.:..::...|.|:.:.:|...|:.||.:|:|:
 Frog   256 NNLITTKYLRSLPRKLLQKLINIYRLDFSMFEYN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 56/250 (22%)
chst9l.1XP_012824242.2 Sulfotransfer_2 70..288 CDD:397568 56/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.