DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13937 and chst11

DIOPT Version :9

Sequence 1:NP_728688.2 Gene:CG13937 / 38249 FlyBaseID:FBgn0035287 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_012813925.1 Gene:chst11 / 100125190 XenbaseID:XB-GENE-955998 Length:352 Species:Xenopus tropicalis


Alignment Length:285 Identity:88/285 - (30%)
Similarity:141/285 - (49%) Gaps:30/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RRERLKDKCSAYGL-----DVLGHDAWHTPNTWEFL-VNKKYHIIWCNVFKAASSSWMFNFNVLA 207
            ||:::.|.|.|..:     .||      |||..:.| |::.:.:|:|.|.|.|.::|.....||.
 Frog    81 RRDQVTDLCRANSVMSRKRRVL------TPNDLKHLVVDEDHEMIYCYVPKVACTNWKRVMMVLT 139

  Fly   208 G---YS-----PSYLRKTKKILLNLARERYPRVTLDELREAQNYSVTFIIARDPFERLLSAYRDK 264
            |   ||     |:.:......|..|.:...|.:.    ...:|| :.|:..|:|||||:||||:|
 Frog   140 GRGKYSDPMEIPANVAHVSSNLKTLNQYSIPEIN----HRLKNY-MKFLFVREPFERLVSAYRNK 199

  Fly   265 MVFALPYSFHDKLGRSIVRNYRKKPSLAARAANTKFPSFPEFVHWLLD-QVKRGSFIDMHFVAAT 328
            .......|||.:.|..|||..||..:..| ..|.....|.|||.:|:| ..::....:.|:....
 Frog   200 FTQKYNTSFHKRYGTKIVRRQRKNATQEA-LHNGNDVKFEEFVAYLIDPHTQKEEPFNEHWQTVF 263

  Fly   329 SFCTPCLIRFDMILKFESLAEDQLYLIEKTGLKRVIA-PVWRNMGKGRKTHELQQQFYAQLTRQE 392
            |.|.||.|.:|:|.|:|:|.||..|::...|:...:. |.:..  ..|.|.|:..:|:..::.:.
 Frog   264 SLCHPCHIHYDLIGKYETLEEDSNYVLHLAGVGDYLKFPTFAK--STRTTDEMTAEFFQNISSEH 326

  Fly   393 MLELYEYYKYDFELFDYDIQEYLQV 417
            .::|||.||.|:.:|:|.:..||::
 Frog   327 QMQLYEVYKLDYLMFNYSMPSYLKL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13937NP_728688.2 Sulfotransfer_2 181..409 CDD:281554 73/237 (31%)
chst11XP_012813925.1 Sulfotransfer_2 113..343 CDD:367564 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.