DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12025 and AT4G29850

DIOPT Version :9

Sequence 1:NP_001261296.1 Gene:CG12025 / 38246 FlyBaseID:FBgn0035285 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_194714.1 Gene:AT4G29850 / 829107 AraportID:AT4G29850 Length:103 Species:Arabidopsis thaliana


Alignment Length:103 Identity:34/103 - (33%)
Similarity:47/103 - (45%) Gaps:15/103 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DSDSLIQEYGNLPTEETNTYCWRHPKVRENWRTVLAAFTLLVVGTGLFVMGTFAIAD--PQNTSQ 129
            |.|.:|         ||:......|.|:|    :..|..|||.||...|.|.|...:  ..:...
plant    12 DEDIMI---------ETSYTVNNRPPVKE----IALAVALLVFGTLGIVSGFFMAYNRVGGDRGH 63

  Fly   130 GVVFFVAGLICFIPGAYHVVYIWLAAKGYRGFDFYHLP 167
            |:.|.|.|.:.||||.|:....:.|.|||:||.|.::|
plant    64 GIFFIVLGCLLFIPGFYYTRIAYYAYKGYKGFSFSNIP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12025NP_001261296.1 DUF872 61..169 CDD:399128 34/103 (33%)
AT4G29850NP_194714.1 DUF872 <30..101 CDD:399128 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4531
eggNOG 1 0.900 - - E1_KOG4753
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2652
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.