DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12025 and TMEM134

DIOPT Version :9

Sequence 1:NP_001261296.1 Gene:CG12025 / 38246 FlyBaseID:FBgn0035285 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_024304465.1 Gene:TMEM134 / 80194 HGNCID:26142 Length:222 Species:Homo sapiens


Alignment Length:162 Identity:45/162 - (27%)
Similarity:71/162 - (43%) Gaps:26/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PMRGKQGRSTEDVSIRIQD--------PKGYNKYAEDTTSRDSDSLIQEYGNLPTEETNTYC--- 87
            |:|.:.|.|...:...:..        |......|..|.:....:.:....:.|.......|   
Human    59 PLRSRMGESAPGIPAELPSAAPSGPSAPSAAAPSAPTTPAAGEPARLSPQPSSPGSTPTASCTPS 123

  Fly    88 --------------W-RHPKVRENWRTVLAAFTLLVVGTGLFVMGTFAIADPQNTSQGVVFFVAG 137
                          | :||.:::|.|.|||:|.||::|..|.::|....|.|.......:|||.|
Human   124 LHLLHIHPALLPPSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPG 188

  Fly   138 LICFIPGAYHVVYIWLAAKGYRGFDFYHLPLF 169
            .:..:||.|||::|:.|.||:|||.|::||.|
Human   189 FLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12025NP_001261296.1 DUF872 61..169 CDD:399128 38/125 (30%)
TMEM134XP_024304465.1 DUF872 <136..220 CDD:310477 35/83 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156706
Domainoid 1 1.000 83 1.000 Domainoid score I8393
eggNOG 1 0.900 - - E1_KOG4753
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5196
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008408
OrthoInspector 1 1.000 - - oto88855
orthoMCL 1 0.900 - - OOG6_110165
Panther 1 1.100 - - LDO PTHR13558
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5767
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.